KEGG   Homo sapiens (human): 30846Help
Entry
30846             CDS       T01001                                 

Gene name
EHD2, PAST2
Definition
(RefSeq) EH domain containing 2
  KO
K12469  EH domain-containing protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    30846 (EHD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5600 EF-hand_4 EHD_N Dynamin_N MMR_HSR1 EF-hand_1 GTP_EFTU EF-hand_7
Motif
Other DBs
NCBI-GeneID: 30846
NCBI-ProteinID: NP_055416
OMIM: 605890
HGNC: 3243
Ensembl: ENSG00000024422
Vega: OTTHUMG00000183266
Pharos: Q9NZN4(Tbio)
UniProt: Q9NZN4 A0A024R0S6
LinkDB All DBs
Position
19q13.33
AA seq 543 aa AA seqDB search
MFSWLKRGGARGQQPEAIRTVTSALKELYRTKLLPLEEHYRFGAFHSPALEDADFDGKPM
VLVAGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGDTEGTVPGNALVVDPDK
PFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAE
RVDLIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWAL
GKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVKR
ARLVRVHAYIISYLKKEMPSVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPDCQKMQ
ELLMAHDFTKFHSLKPKLLEALDEMLTHDIAKLMPLLRQEELESTEVGVQGGAFEGTHMG
PFVERGPDEAMEDGEEGSDDEAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTK
LPNSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPANLPRRLVPPSKRRHKG
SAE
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgttcagctggctgaagcggggcggggcacggggccagcagcccgaggccatccgcacg
gtgacctcggccctcaaggagctgtaccgcacgaagctgctgccgctggaggagcactac
cgctttggggccttccactcgccggccctggaggacgcagacttcgacggcaagcccatg
gtgctggtggccggccagtacagcacgggcaagaccagcttcatccagtacctgctggag
caggaggtgcccggctcccgcgtggggcctgagcccaccaccgactgctttgtggccgtc
atgcacggggacactgagggcaccgtgcccggcaacgccctcgtcgtggacccggacaag
cccttccgcaaactcaaccctttcggaaacaccttcctcaacaggttcatgtgtgcccag
ctccctaatcaggtcctggagagcatcagcatcatcgacaccccgggtatcctgtcgggt
gccaagcagagagtgagccgcggctacgacttcccggccgtgctgcgctggttcgcggag
cgcgtggacctcatcatcctgctctttgatgcgcacaagctggagatctcggacgagttc
tcagaggccatcggcgcgttgcggggccatgaggacaagatccgcgtggtgctcaacaag
gccgacatggtggagacgcagcagctgatgcgcgtctacggcgcgctcatgtgggcgctg
ggcaaggtggtgggcacgcccgaggtgctgcgcgtctacatcggctccttctggtcccag
cccctcctcgtgcccgacaaccggcgcctcttcgagctggaggagcaggacctcttccgc
gacatccagggcctgccccggcacgcagccttgcgcaagctcaacgacctggtgaagagg
gcccggctggtgcgagttcacgcttacatcatcagctacctgaagaaggagatgccctct
gtgtttgggaaggagaacaagaagaagcagctgatcctcaaactgcccgtcatctttgcg
aagattcagctggaacatcacatctcccctggggactttcctgattgccagaaaatgcag
gagctgctgatggcgcacgacttcaccaagtttcactcgctgaagccgaagctgctagag
gcactggacgagatgctgacgcacgacatcgccaagctcatgcccctgctgcggcaggag
gagctggagagcaccgaggtgggcgtgcaggggggcgcttttgagggcacccacatgggc
ccgtttgtggagcggggacctgacgaggccatggaggacggcgaggagggctcggacgac
gaggccgagtgggtggtgaccaaggacaagtccaaatacgacgagatcttctacaacctg
gcgcctgccgacggcaagctgagcggctccaaggccaagacctggatggtggggaccaag
ctccccaactcagtgctggggcgcatctggaagctcagcgatgtggaccgcgacggcatg
ctggatgatgaggagttcgcgctggccagccacctcatcgaggccaagctggaaggccac
gggctgcccgccaacctgccccgtcgcctggtgccaccctccaagcgacgccacaagggc
tccgccgagtga

DBGET integrated database retrieval system