KEGG   Homo sapiens (human): 30849
Entry
30849             CDS       T01001                                 

Gene name
PIK3R4, VPS15, p150
Definition
(RefSeq) phosphoinositide-3-kinase regulatory subunit 4
  KO
K08333  phosphoinositide-3-kinase, regulatory subunit 4 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04371  Apelin signaling pathway
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
Network
nt06125  Membrane trafficking (bacteria)
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
  Element
N00155  Autophagy-vesicle nucleation
N00962  Mutation-inactivated ATXN3 to autophagy-vesicle nucleation
N00993  Mutation-caused aberrant Htt to autophagy-vesicle nucleation
N01302  Early endosomal fusion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    30849 (PIK3R4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    30849 (PIK3R4)
   04136 Autophagy - other
    30849 (PIK3R4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    30849 (PIK3R4)
   05014 Amyotrophic lateral sclerosis
    30849 (PIK3R4)
   05016 Huntington disease
    30849 (PIK3R4)
   05017 Spinocerebellar ataxia
    30849 (PIK3R4)
   05022 Pathways of neurodegeneration - multiple diseases
    30849 (PIK3R4)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    30849 (PIK3R4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    30849 (PIK3R4)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    30849 (PIK3R4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     30849 (PIK3R4)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  VPS15 family
   30849 (PIK3R4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    30849 (PIK3R4)
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    30849 (PIK3R4)
SSDB
Motif
Pfam: Pkinase WD40 HEAT PK_Tyr_Ser-Thr IFRD HEAT_2
Other DBs
NCBI-GeneID: 30849
NCBI-ProteinID: NP_055417
OMIM: 602610
HGNC: 8982
Ensembl: ENSG00000196455
Vega: OTTHUMG00000159645
Pharos: Q99570(Tbio)
UniProt: Q99570
LinkDB
Position
3q22.1
AA seq 1358 aa
MGNQLAGIAPSQILSVESYFSDIHDFEYDKSLGSTRFFKVARAKHREGLVVVKVFAIQDP
TLPLTSYKQELEELKIRLNSAQNCLPFQKASEKASEKAAMLFRQYVRDNLYDRISTRPFL
NNIEKRWIAFQILTAVDQAHKSGVRHGDIKTENVMVTSWNWVLLTDFASFKPTYLPEDNP
ADFNYFFDTSRRRTCYIAPERFVDGGMFATELEYMRDPSTPLVDLNSNQRTRGELKRAMD
IFSAGCVIAELFTEGVPLFDLSQLLAYRNGHFFPEQVLNKIEDHSIRELVTQMIHREPDK
RLEAEDYLKQQRGNAFPEIFYTFLQPYMAQFAKETFLSADERILVIRKDLGNIIHNLCGH
DLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRLSVEILLDRITP
YLLHFSNDSVPRVRAEALRTLTKVLALVKEVPRNDINIYPEYILPGIAHLAQDDATIVRL
AYAENIALLAETALRFLELVQLKNLNMENDPNNEEIDEVTHPNGNYDTELQALHEMVQQK
VVTLLSDPENIVKQTLMENGITRLCVFFGRQKANDVLLSHMITFLNDKNDWHLRGAFFDS
IVGVAAYVGWQSSSILKPLLQQGLSDAEEFVIVKALYALTCMCQLGLLQKPHVYEFASDI
APFLCHPNLWIRYGAVGFITVVARQISTADVYCKLMPYLDPYITQPIIQIERKLVLLSVL
KEPVSRSIFDYALRSKDITSLFRHLHMRQKKRNGSLPDCPPPEDPAIAQLLKKLLSQGMT
EEEEDKLLALKDFMMKSNKAKANIVDQSHLHDSSQKGVIDLAALGITGRQVDLVKTKQEP
DDKRARKHVKQDSNVNEEWKSMFGSLDPPNMPQALPKGSDQEVIQTGKPPRSESSAGICV
PLSTSSQVPEVTTVQNKKPVIPVLSSTILPSTYQIRITTCKTELQQLIQQKREQCNAERI
AKQMMENAEWESKPPPPGWRPKGLLVAHLHEHKSAVNRIRVSDEHSLFATCSNDGTVKIW
NSQKMEGKTTTTRSILTYSRIGGRVKTLTFCQGSHYLAIASDNGAVQLLGIEASKLPKSP
KIHPLQSRILDQKEDGCVVDMHHFNSGAQSVLAYATVNGSLVGWDLRSSSNAWTLKHDLK
SGLITSFAVDIHQCWLCIGTSSGTMACWDMRFQLPISSHCHPSRARIRRLSMHPLYQSWV
IAAVQGNNEVSMWDMETGDRRFTLWASSAPPLSELQPSPHSVHGIYCSPADGNPILLTAG
SDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRG
PESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK
NT seq 4077 nt   +upstreamnt  +downstreamnt
atgggaaatcagcttgctggcattgctccctcccagatcctttctgtagagagttatttt
tcagatattcatgactttgaatatgataaaagcctggggagtactcggttttttaaagtt
gctcgagccaagcaccgagaaggcctggtcgttgtgaaggtttttgcaattcaggatccc
acattgcctttaaccagctataaacaagagctggaggaactgaaaatcaggcttaattct
gcacagaattgtctacctttccagaaagcatcagaaaaagcatctgagaaagcagctatg
ctctttaggcagtatgtgcgagacaatctctatgatcgcatcagtacccgtccattcttg
aataacattgagaagcgctggattgctttccagatcctgacagctgtggaccaagcacac
aaatctggagttcgtcatggggacatcaagactgagaatgtgatggtcaccagttggaat
tgggttcttctaactgattttgccagttttaagcccacttatcttccagaagacaacccg
gcagatttcaattatttctttgacacatcacggaggagaacttgctatattgctcctgaa
cgttttgttgatggtgggatgtttgccactgagttagaatatatgagagatccttcaact
ccgcttgtagacttaaatagcaatcagagaacaagaggagagttgaagagagcaatggac
atcttttcagcaggttgtgtgatagctgagctttttacagaaggtgtaccattatttgat
ctctctcaacttttggcttatagaaatggacattttttccctgaacaagtgctaaataaa
attgaagatcacagtatcagagaattggtaactcagatgattcaccgtgagccagataaa
cgtttagaggcagaagattacttaaaacagcagcgtggcaatgcctttcctgaaatattt
tacacttttcttcagccctacatggcccagtttgccaaggaaacgtttctttctgcagat
gagcgtattctggttatacggaaggatttgggcaacattattcacaatctctgtggacat
gatctgccagaaaaagccgaaggagagcctaaggaaaatgggctggttatcttggtatct
gttataacatcctgcctacagacccttaaatactgtgattccaaactagctgctttggaa
ctgattcttcatttggctccaagattaagtgttgaaatccttttggatcgtattactcca
tatcttttgcatttcagcaatgactctgttcctagggtgagggctgaagccttgaggacg
ttgaccaaagttcttgctctcgtcaaagaggttcctcgtaatgatatcaatatttatccg
gaatacattctgccaggcatagcccacttagcccaagatgatgctactatcgttagacta
gcctatgctgaaaacatagctctgctggcagaaacagctctgagattcctggaattagta
cagttaaaaaatcttaatatggaaaatgaccccaataatgaagaaatagatgaggttaca
catccaaatggaaattatgacacagagctccaagccttacatgaaatggtccagcagaaa
gttgttactttgctaagtgaccctgaaaatattgtaaaacaaaccttgatggaaaatgga
ataacacggctgtgtgtattctttggacgtcagaaagccaacgatgttttgttgtcccac
atgattactttcctaaatgataagaatgattggcatctacgtggagcattttttgatagt
atagttggtgttgctgcctatgttggctggcaaagctcctcaattctcaagcctctgctg
caacaaggtcttagtgatgctgaggaatttgtcattgtgaaagctctttatgcccttact
tgtatgtgccagttaggactgctacaaaaaccccatgtttacgaatttgccagtgatatt
gcccccttcctgtgtcatcccaatttatggatacgttatggtgccgtgggatttatcaca
gtggtagctcgtcaaataagtacagctgatgtctactgtaaactgatgccttatcttgac
ccatatattacccaaccaataatacagattgaaagaaaacttgttctgctcagtgtttta
aaggaaccagtaagtcgttctatatttgattatgctttgaggtctaaagatattactagc
ttgttcagacatcttcacatgcgtcagaagaaacgaaatggttctcttcccgactgccct
ccgccagaggatcctgccatagcacagcttctgaagaagttgctctcacagggaatgaca
gaggaagaggaagacaaacttctggcactgaaagacttcatgatgaaatctaataaagca
aaggccaatatagtggaccagagccatcttcatgatagtagtcagaaaggtgtaattgac
ttggcagctttaggcataactgggagacaagttgatcttgttaaaaccaaacaagaacca
gatgacaaacgggccagaaaacatgtaaaacaagactcaaatgtaaatgaagaatggaaa
agcatgtttgggtcactggacccaccaaacatgccacaggccctacctaaagggagtgat
caggaggtgattcagactgggaaacctcctcgttccgagtcctctgctggcatttgtgtc
cctttgtcaacttcttcacaggttccagaagtgacaactgtccaaaataaaaaaccagta
ataccggttttaagtagtacaatcttaccatccacctatcagattcgaattacaacttgt
aaaactgaacttcagcaactcatccagcaaaagcgggagcagtgcaatgctgagagaata
gctaagcagatgatggaaaatgctgaatgggagagtaaaccaccaccacctggatggcgt
cctaaagggctgttagttgcccatcttcatgagcataaatctgctgtgaatcgaattaga
gtctctgatgaacactcactttttgcaacatgttcaaatgatggcacagtgaaaatctgg
aacagtcaaaagatggaggggaagaccaccactaccagatctattcttacatacagccga
attggaggacgagtcaagacgctcacattctgccaaggctcccactatttagccatagca
tctgataatggtgctgtccagcttcttggaattgaggcttctaagctgcccaagtctcct
aaaatccatcctctacaaagcagaattctagatcagaaggaggacggttgtgttgtggat
atgcatcacttcaactctggagcacagtctgttcttgcctatgccactgtgaatggctct
ctggttggctgggaccttaggtcttcaagcaatgcgtggactttaaagcatgatttaaag
tcgggcctcatcacttcctttgctgtggacatccaccaatgctggctctgcattggtaca
agcagtggtaccatggcttgttgggacatgaggttccagttgccaatttcaagtcactgt
catccttccagggctcgaatcagacgcctctcaatgcaccctctgtatcagtcctgggtg
attgcagctgttcagggcaacaacgaagtgtccatgtgggacatggagactggtgacaga
agatttactctctgggccagcagtgcaccaccactttctgaattacagccttctcctcat
agcgtccatggtatctactgtagtcctgcagatggaaatcctatcctactaacagctggc
tcagatatgaaaataaggttttgggacttggcttacccagaaaggtcctatgttgttgca
ggaagtactagttccccatctgtgtcctactacaggaaaataattgaaggcactgaagtt
gtccaggaaattcagaataagcagaaagtaggaccaagtgatgacacccctcgaaggggc
ccagagtccctgcccgtgggacatcatgacatcatcactgatgtcgccacattccagacc
acacagggcttcatcgtaactgcttctagagatgggattgtgaaggtgtggaaataa

KEGG   Homo sapiens (human): 5289
Entry
5289              CDS       T01001                                 

Gene name
PIK3C3, VPS34, hVps34
Definition
(RefSeq) phosphatidylinositol 3-kinase catalytic subunit type 3
  KO
K00914  phosphatidylinositol 3-kinase [EC:2.7.1.137]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
hsa04145  Phagosome
hsa04371  Apelin signaling pathway
hsa05010  Alzheimer disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05017  Spinocerebellar ataxia
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05152  Tuberculosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06125  Membrane trafficking (bacteria)
nt06128  Autophagy (viruses and bacteria)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06228  Autophagy
nt06413  Autophagy
nt06461  Huntington disease
nt06462  Spinocerebellar ataxia
  Element
N00155  Autophagy-vesicle nucleation
N00177  KSHV vBCL2 to autophagy-vesicle nucleation
N00962  Mutation-inactivated ATXN3 to autophagy-vesicle nucleation
N00993  Mutation-caused aberrant Htt to autophagy-vesicle nucleation
N01302  Early endosomal fusion
N01303  Salmonella SopB to Early endosomal fusion
Drug target
Fimepinostat: D11319
Safingol: D05784
Safingol hydrochloride: D05785
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    5289 (PIK3C3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    5289 (PIK3C3)
   04070 Phosphatidylinositol signaling system
    5289 (PIK3C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    5289 (PIK3C3)
   04140 Autophagy - animal
    5289 (PIK3C3)
   04136 Autophagy - other
    5289 (PIK3C3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5289 (PIK3C3)
   05014 Amyotrophic lateral sclerosis
    5289 (PIK3C3)
   05016 Huntington disease
    5289 (PIK3C3)
   05017 Spinocerebellar ataxia
    5289 (PIK3C3)
   05022 Pathways of neurodegeneration - multiple diseases
    5289 (PIK3C3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5289 (PIK3C3)
   05131 Shigellosis
    5289 (PIK3C3)
   05152 Tuberculosis
    5289 (PIK3C3)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    5289 (PIK3C3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5289 (PIK3C3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.137  phosphatidylinositol 3-kinase
     5289 (PIK3C3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    5289 (PIK3C3)
  Rab GTPases and associated proteins
   Rab associated proteins
    5289 (PIK3C3)
 Endosome - Lysosome transport
    5289 (PIK3C3)
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    5289 (PIK3C3)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_C2 HEAT_2
Other DBs
NCBI-GeneID: 5289
NCBI-ProteinID: NP_002638
OMIM: 602609
HGNC: 8974
Ensembl: ENSG00000078142
Vega: OTTHUMG00000132593
Pharos: Q8NEB9(Tchem)
UniProt: Q8NEB9
LinkDB
Structure
PDB: 

Position
18q12.3
AA seq 887 aa
MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVT
CQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAV
PVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTK
AHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDG
DESSPILTSFELVKVPDPQMSMENLVESKHHKLARSLRSGPSDHDLKPNAATRDQLNIIV
SYPPTKQLTYEEQDLVWKFRYYLTNQEKALTKFLKCVNWDLPQEAKQALELLGKWKPMDV
EDSLELLSSHYTNPTVRRYAVARLRQADDEDLLMYLLQLVQALKYENFDDIKNGLEPTKK
DSQSSVSENVSNSGINSAEIDSSQIITSPLPSVSSPPPASKTKEVPDGENLEQDLCTFLI
SRACKNSTLANYLYWYVIVECEDQDTQQRDPKTHEMYLNVMRRFSQALLKGDKSVRVMRS
LLAAQQTFVDRLVHLMKAVQRESGNRKKKNERLQALLGDNEKMNLSDVELIPLPLEPQVK
IRGIIPETATLFKSALMPAQLFFKTEDGGKYPVIFKHGDDLRQDQLILQIISLMDKLLRK
ENLDLKLTPYKVLATSTKHGFMQFIQSVPVAEVLDTEGSIQNFFRKYAPSENGPNGISAE
VMDTYVKSCAGYCVITYILGVGDRHLDNLLLTKTGKLFHIDFGYILGRDPKPLPPPMKLN
KEMVEGMGGTQSEQYQEFRKQCYTAFLHLRRYSNLILNLFSLMVDANIPDIALEPDKTVK
KVQDKFRLDLSDEEAVHYMQSLIDESVHALFAAVVEQIHKFAQYWRK
NT seq 2664 nt   +upstreamnt  +downstreamnt
atgggggaagcagagaagtttcactacatctatagttgtgacctggatatcaacgtccag
cttaagataggaagcttggaagggaagagagaacaaaagagttataaagctgtcctggaa
gacccaatgttgaagttctcaggactatatcaagagacatgctctgatctttatgttact
tgtcaagtttttgcagaagggaagcctttggccttgccagtgagaacatcctacaaagca
tttagtacaagatggaactggaatgaatggctgaaactaccagtaaaataccctgacctg
cccaggaatgcccaagtggccctcaccatatgggatgtgtatggtcccggaaaagcagtg
cctgtaggaggaacaacggtttcgctctttggaaaatacggcatgtttcgccaagggatg
catgacttgaaagtctggcctaatgtagaagcagatggatcagaacccacaaaaactcct
ggcagaacaagtagcactctctcagaagatcagatgagccgtcttgccaagctcaccaaa
gctcatcgacaaggacacatggtgaaagtagattggctggatagattgacatttagagaa
atagaaatgataaatgagagtgaaaaacgaagttctaatttcatgtacctgatggttgaa
tttcgatgtgtcaagtgtgatgataaggaatatggtattgtttattatgaaaaggacggt
gatgaatcatctccaattttaacaagttttgaattagtgaaagttcctgacccccagatg
tctatggagaatttagttgagagcaaacaccacaagcttgcccggagtttaagaagtgga
ccttctgaccacgatctgaaacccaatgctgccacgagagatcagttaaatattattgtg
agttatccaccaaccaagcaacttacatatgaagaacaagatcttgtttggaagtttaga
tattatcttacgaatcaagaaaaagccttgacaaaattcttgaaatgtgttaattgggat
ctacctcaagaggccaaacaggccttggaacttctgggaaaatggaagccgatggatgta
gaggactccttggagctgttatcctctcattacaccaacccaactgtgaggcgttatgct
gttgcccggttgcgacaggccgatgatgaggatttgttgatgtacctattacaattggtc
caggctctcaaatatgaaaattttgatgatataaagaatggattggaacctaccaagaag
gatagtcagagttcagtgtcagaaaatgtgtcaaattctggaataaattctgcagaaata
gatagctcccaaattataaccagcccccttccttcagtctcttcacctcctcctgcatca
aaaacaaaagaagttccagatggcgaaaatctggaacaagatctctgtaccttcttgata
tcgagagcctgcaaaaactcaacactggctaattatttatactggtatgtgatagtggaa
tgtgaagatcaagatactcagcagagagatccaaagacccatgagatgtacttgaacgta
atgagaagattcagccaagcattgttgaagggtgataagtctgtcagagttatgcgttct
ttgctggctgcacaacagacatttgtagatcggttggtgcatctaatgaaggcagtacaa
cgcgaaagtggaaatcgtaagaaaaagaatgagagactacaggcattgcttggagataat
gaaaagatgaatttgtcagatgtggaacttatcccgttgcctttagaaccccaagtgaaa
attagaggaataattccggaaacagctacactgtttaaaagtgcccttatgcctgcacag
ttgttttttaagacggaagatggaggcaaatatccagttatatttaagcatggagatgat
ttacgtcaagatcaacttattcttcaaatcatttcactcatggacaagctgttacggaaa
gaaaatctggacttgaaattgacaccttataaggtgttagccaccagtacaaaacatggc
ttcatgcagtttatccagtcagttcctgtggctgaagttcttgatacagagggaagcatt
cagaacttttttagaaaatatgcaccaagtgagaatgggccaaatgggattagtgctgag
gtcatggacacttacgttaaaagctgtgctggatattgcgtgatcacctatatacttgga
gttggagacaggcacctggataaccttttgctaacaaaaacaggcaaactcttccacata
gactttggatatattttgggtcgggatccaaagcctcttcctccaccaatgaagctgaat
aaagaaatggtagaaggaatggggggcacacagagtgagcagtaccaagagttccgtaaa
cagtgttacacggctttcctccacctgcgaaggtattctaatctgattttgaacttgttt
tccttgatggttgatgcaaacattccagatattgcacttgaaccagataaaactgtgaaa
aaggttcaggataaattccgcttagacctgtcggatgaagaggctgtgcattacatgcag
agtctgattgatgagagtgtccatgctctttttgctgcagtggtggaacagattcacaag
tttgcccagtactggagaaaatga

DBGET integrated database retrieval system