KEGG   Homo sapiens (human): 3091Help
Entry
3091              CDS       T01001                                 

Gene name
HIF1A, HIF-1-alpha, HIF-1A, HIF-1alpha, HIF1, HIF1-ALPHA, MOP1, PASD8, bHLHe78
Definition
(RefSeq) hypoxia inducible factor 1 subunit alpha
  KO
K08268  hypoxia-inducible factor 1 alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04659  Th17 cell differentiation
hsa04919  Thyroid hormone signaling pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05211  Renal cell carcinoma
hsa05230  Central carbon metabolism in cancer
hsa05231  Choline metabolism in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06124  Chemokine signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
nt06225  HIF-1 signaling
nt06264  Renal cell carcinoma
  Element
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
Disease
H01509  Tonsillar cancer
Drug target
Firtecan pegol: D10464
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    3091 (HIF1A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    3091 (HIF1A)
   04137 Mitophagy - animal
    3091 (HIF1A)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    3091 (HIF1A)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    3091 (HIF1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3091 (HIF1A)
   05205 Proteoglycans in cancer
    3091 (HIF1A)
   05230 Central carbon metabolism in cancer
    3091 (HIF1A)
   05231 Choline metabolism in cancer
    3091 (HIF1A)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    3091 (HIF1A)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    3091 (HIF1A)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    3091 (HIF1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3091 (HIF1A)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    3091 (HIF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS_11 HIF-1a_CTAD PAS HIF-1 PAS_9 PAS_4 DDRGK HLH
Motif
Other DBs
NCBI-GeneID: 3091
NCBI-ProteinID: NP_001521
OMIM: 603348
HGNC: 4910
Ensembl: ENSG00000100644
Vega: OTTHUMG00000140344
Pharos: Q16665(Tchem)
UniProt: Q16665 D0VY79
LinkDB All DBs
Structure
PDB: 

Position
14q23.2
AA seq 826 aa AA seqDB search
MEGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVSSHLDKASVM
RLTISYLRVRKLLDAGDLDIEDDMKAQMNCFYLKALDGFVMVLTDDGDMIYISDNVNKYM
GLTQFELTGHSVFDFTHPCDHEEMREMLTHRNGLVKKGKEQNTQRSFFLRMKCTLTSRGR
TMNIKSATWKVLHCTGHIHVYDTNSNQPQCGYKKPPMTCLVLICEPIPHPSNIEIPLDSK
TFLSRHSLDMKFSYCDERITELMGYEPEELLGRSIYEYYHALDSDHLTKTHHDMFTKGQV
TTGQYRMLAKRGGYVWVETQATVIYNTKNSQPQCIVCVNYVVSGIIQHDLIFSLQQTECV
LKPVESSDMKMTQLFTKVESEDTSSLFDKLKKEPDALTLLAPAAGDTIISLDFGSNDTET
DDQQLEEVPLYNDVMLPSPNEKLQNINLAMSPLPTAETPKPLRSSADPALNQEVALKLEP
NPESLELSFTMPQIQDQTPSPSDGSTRQSSPEPNSPSEYCFYVDSDMVNEFKLELVEKLF
AEDTEAKNPFSTQDTDLDLEMLAPYIPMDDDFQLRSFDQLSPLESSSASPESASPQSTVT
VFQQTQIQEPTANATTTTATTDELKTVTKDRMEDIKILIASPSPTHIHKETTSATSSPYR
DTQSRTASPNRAGKGVIEQTEKSHPRSPNVLSVALSQRTTVPEEELNPKILALQNAQRKR
KMEHDGSLFQAVGIGTLLQQPDDHAATTSLSWKRVKGCKSSEQNGMEQKTIILIPSDLAC
RLLGQSMDESGLPQLTSYDCEVNAPIQGSRNLLQGEELLRALDQVN
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggagggcgccggcggcgcgaacgacaagaaaaagataagttctgaacgtcgaaaagaa
aagtctcgagatgcagccagatctcggcgaagtaaagaatctgaagttttttatgagctt
gctcatcagttgccacttccacataatgtgagttcgcatcttgataaggcctctgtgatg
aggcttaccatcagctatttgcgtgtgaggaaacttctggatgctggtgatttggatatt
gaagatgacatgaaagcacagatgaattgcttttatttgaaagccttggatggttttgtt
atggttctcacagatgatggtgacatgatttacatttctgataatgtgaacaaatacatg
ggattaactcagtttgaactaactggacacagtgtgtttgattttactcatccatgtgac
catgaggaaatgagagaaatgcttacacacagaaatggccttgtgaaaaagggtaaagaa
caaaacacacagcgaagcttttttctcagaatgaagtgtaccctaactagccgaggaaga
actatgaacataaagtctgcaacatggaaggtattgcactgcacaggccacattcacgta
tatgataccaacagtaaccaacctcagtgtgggtataagaaaccacctatgacctgcttg
gtgctgatttgtgaacccattcctcacccatcaaatattgaaattcctttagatagcaag
actttcctcagtcgacacagcctggatatgaaattttcttattgtgatgaaagaattacc
gaattgatgggatatgagccagaagaacttttaggccgctcaatttatgaatattatcat
gctttggactctgatcatctgaccaaaactcatcatgatatgtttactaaaggacaagtc
accacaggacagtacaggatgcttgccaaaagaggtggatatgtctgggttgaaactcaa
gcaactgtcatatataacaccaagaattctcaaccacagtgcattgtatgtgtgaattac
gttgtgagtggtattattcagcacgacttgattttctcccttcaacaaacagaatgtgtc
cttaaaccggttgaatcttcagatatgaaaatgactcagctattcaccaaagttgaatca
gaagatacaagtagcctctttgacaaacttaagaaggaacctgatgctttaactttgctg
gccccagccgctggagacacaatcatatctttagattttggcagcaacgacacagaaact
gatgaccagcaacttgaggaagtaccattatataatgatgtaatgctcccctcacccaac
gaaaaattacagaatataaatttggcaatgtctccattacccaccgctgaaacgccaaag
ccacttcgaagtagtgctgaccctgcactcaatcaagaagttgcattaaaattagaacca
aatccagagtcactggaactttcttttaccatgccccagattcaggatcagacacctagt
ccttccgatggaagcactagacaaagttcacctgagcctaatagtcccagtgaatattgt
ttttatgtggatagtgatatggtcaatgaattcaagttggaattggtagaaaaacttttt
gctgaagacacagaagcaaagaacccattttctactcaggacacagatttagacttggag
atgttagctccctatatcccaatggatgatgacttccagttacgttccttcgatcagttg
tcaccattagaaagcagttccgcaagccctgaaagcgcaagtcctcaaagcacagttaca
gtattccagcagactcaaatacaagaacctactgctaatgccaccactaccactgccacc
actgatgaattaaaaacagtgacaaaagaccgtatggaagacattaaaatattgattgca
tctccatctcctacccacatacataaagaaactactagtgccacatcatcaccatataga
gatactcaaagtcggacagcctcaccaaacagagcaggaaaaggagtcatagaacagaca
gaaaaatctcatccaagaagccctaacgtgttatctgtcgctttgagtcaaagaactaca
gttcctgaggaagaactaaatccaaagatactagctttgcagaatgctcagagaaagcga
aaaatggaacatgatggttcactttttcaagcagtaggaattggaacattattacagcag
ccagacgatcatgcagctactacatcactttcttggaaacgtgtaaaaggatgcaaatct
agtgaacagaatggaatggagcaaaagacaattattttaataccctctgatttagcatgt
agactgctggggcaatcaatggatgaaagtggattaccacagctgaccagttatgattgt
gaagttaatgctcctatacaaggcagcagaaacctactgcagggtgaagaattactcaga
gctttggatcaagttaactga

DBGET integrated database retrieval system