KEGG   Homo sapiens (human): 3105Help
Entry
3105              CDS       T01001                                 

Gene name
HLA-A, HLAA
Definition
(RefSeq) major histocompatibility complex, class I, A
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01694  Stevens-Johnson syndrome
H01713  Diffuse panbronchiolitis
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3105 (HLA-A)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3105 (HLA-A)
   04145 Phagosome
    3105 (HLA-A)
  09143 Cell growth and death
   04218 Cellular senescence
    3105 (HLA-A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3105 (HLA-A)
   04612 Antigen processing and presentation
    3105 (HLA-A)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3105 (HLA-A)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3105 (HLA-A)
   05330 Allograft rejection
    3105 (HLA-A)
   05332 Graft-versus-host disease
    3105 (HLA-A)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3105 (HLA-A)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3105 (HLA-A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3105 (HLA-A)
   05170 Human immunodeficiency virus 1 infection
    3105 (HLA-A)
   05168 Herpes simplex virus 1 infection
    3105 (HLA-A)
   05163 Human cytomegalovirus infection
    3105 (HLA-A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3105 (HLA-A)
   05169 Epstein-Barr virus infection
    3105 (HLA-A)
   05165 Human papillomavirus infection
    3105 (HLA-A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3105 (HLA-A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3105 (HLA-A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3105 (HLA-A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3105 (HLA-A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 3105
NCBI-ProteinID: NP_001229687
OMIM: 142800
HGNC: 4931
Ensembl: ENSG00000206503
Vega: OTTHUMG00000130501
Pharos: P30443(Tbio)
UniProt: P04439 B1PKY1 B2R7U3
LinkDB All DBs
Structure
PDB: 

Position
6p22.1
AA seq 365 aa AA seqDB search
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRF
DSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQ
IMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQR
RVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEL
SSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSL
TACKV
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggccgtcatggcgccccgaaccctcctcctgctactctcgggggccctggccctgacc
cagacctgggcgggctcccactccatgaggtatttcttcacatccgtgtcccggcccggc
cgcggggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagccagaagatggagccgcgggcgccgtggatagagcaggagggg
ccggagtattgggaccaggagacacggaatatgaaggcccactcacagactgaccgagcg
aacctggggaccctgcgcggctactacaaccagagcgaggacggttctcacaccatccag
ataatgtatggctgcgacgtggggccggacgggcgcttcctccgcgggtaccggcaggac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcttggaccgcggcg
gacatggcagctcagatcaccaagcgcaagtgggaggcggtccatgcggcggagcagcgg
agagtctacctggagggccggtgcgtggacgggctccgcagatacctggagaacgggaag
gagacgctgcagcgcacggacccccccaagacacatatgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacacggagctcgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcggctgtggtggtgccttctggagaggagcagaga
tacacctgccatgtgcagcatgagggtctgcccaagcccctcaccctgagatgggagctg
tcttcccagcccaccatccccatcgtgggcatcattgctggcctggttctccttggagct
gtgatcactggagctgtggtcgctgccgtgatgtggaggaggaagagctcagatagaaaa
ggagggagttacactcaggctgcaagcagtgacagtgcccagggctctgatgtgtctctc
acagcttgtaaagtgtga

KEGG   Homo sapiens (human): 3106Help
Entry
3106              CDS       T01001                                 

Gene name
HLA-B, AS, B-4901, HLAB
Definition
(RefSeq) major histocompatibility complex, class I, B
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01476  Behcet disease
H01507  Seronegative arthritis
H01674  Ankylosing spondylitis
H01694  Stevens-Johnson syndrome
H01713  Diffuse panbronchiolitis
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3106 (HLA-B)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3106 (HLA-B)
   04145 Phagosome
    3106 (HLA-B)
  09143 Cell growth and death
   04218 Cellular senescence
    3106 (HLA-B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3106 (HLA-B)
   04612 Antigen processing and presentation
    3106 (HLA-B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3106 (HLA-B)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3106 (HLA-B)
   05330 Allograft rejection
    3106 (HLA-B)
   05332 Graft-versus-host disease
    3106 (HLA-B)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3106 (HLA-B)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3106 (HLA-B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3106 (HLA-B)
   05170 Human immunodeficiency virus 1 infection
    3106 (HLA-B)
   05168 Herpes simplex virus 1 infection
    3106 (HLA-B)
   05163 Human cytomegalovirus infection
    3106 (HLA-B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3106 (HLA-B)
   05169 Epstein-Barr virus infection
    3106 (HLA-B)
   05165 Human papillomavirus infection
    3106 (HLA-B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3106 (HLA-B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3106 (HLA-B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3106 (HLA-B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3106 (HLA-B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 3106
NCBI-ProteinID: NP_005505
OMIM: 142830
HGNC: 4932
Ensembl: ENSG00000234745
Vega: OTTHUMG00000031153
Pharos: P01889(Tbio)
UniProt: P01889 E5FQ95
LinkDB All DBs
Structure
PDB: 

Position
6p21.33
AA seq 362 aa AA seqDB search
MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQ
SMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQR
RAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEP
SSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGKGGSYSQAACSDSAQGSDVSL
TA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgctggtcatggcgccccgaaccgtcctcctgctgctctcggcggccctggccctgacc
gagacctgggccggctcccactccatgaggtatttctacacctccgtgtcccggcccggc
cgcggggagccccgcttcatctcagtgggctacgtggacgacacccagttcgtgaggttc
gacagcgacgccgcgagtccgagagaggagccgcgggcgccgtggatagagcaggagggg
ccggagtattgggaccggaacacacagatctacaaggcccaggcacagactgaccgagag
agcctgcggaacctgcgcggctactacaaccagagcgaggccgggtctcacaccctccag
agcatgtacggctgcgacgtggggccggacgggcgcctcctccgcgggcatgaccagtac
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacacggcggctcagatcacccagcgcaagtgggaggcggcccgtgaggcggagcagcgg
agagcctacctggagggcgagtgcgtggagtggctccgcagatacctggagaacgggaag
gacaagctggagcgcgctgaccccccaaagacacacgtgacccaccaccccatctctgac
catgaggccaccctgaggtgctgggccctgggtttctaccctgcggagatcacactgacc
tggcagcgggatggcgaggaccaaactcaggacactgagcttgtggagaccagaccagca
ggagatagaaccttccagaagtgggcagctgtggtggtgccttctggagaagagcagaga
tacacatgccatgtacagcatgaggggctgccgaagcccctcaccctgagatgggagccg
tcttcccagtccaccgtccccatcgtgggcattgttgctggcctggctgtcctagcagtt
gtggtcatcggagctgtggtcgctgctgtgatgtgtaggaggaagagttcaggtggaaaa
ggagggagctactctcaggctgcgtgcagcgacagtgcccagggctctgatgtgtctctc
acagcttga

KEGG   Homo sapiens (human): 3107Help
Entry
3107              CDS       T01001                                 

Gene name
HLA-C, D6S204, HLA-JY3, HLAC, HLC-C, MHC, PSORS1
Definition
(RefSeq) major histocompatibility complex, class I, C
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
H01656  Psoriasis
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3107 (HLA-C)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3107 (HLA-C)
   04145 Phagosome
    3107 (HLA-C)
  09143 Cell growth and death
   04218 Cellular senescence
    3107 (HLA-C)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3107 (HLA-C)
   04612 Antigen processing and presentation
    3107 (HLA-C)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3107 (HLA-C)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3107 (HLA-C)
   05330 Allograft rejection
    3107 (HLA-C)
   05332 Graft-versus-host disease
    3107 (HLA-C)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3107 (HLA-C)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3107 (HLA-C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3107 (HLA-C)
   05170 Human immunodeficiency virus 1 infection
    3107 (HLA-C)
   05168 Herpes simplex virus 1 infection
    3107 (HLA-C)
   05163 Human cytomegalovirus infection
    3107 (HLA-C)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3107 (HLA-C)
   05169 Epstein-Barr virus infection
    3107 (HLA-C)
   05165 Human papillomavirus infection
    3107 (HLA-C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3107 (HLA-C)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3107 (HLA-C)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3107 (HLA-C)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3107 (HLA-C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 MHC_I_3 ig DUF4448 FeoB_associated
Motif
Other DBs
NCBI-GeneID: 3107
NCBI-ProteinID: NP_002108
OMIM: 142840
HGNC: 4933
Ensembl: ENSG00000204525
Vega: OTTHUMG00000031154
Pharos: P10321(Tbio)
UniProt: P10321 Q6R739 Q95HC2
LinkDB All DBs
Structure
PDB: 

Position
6p21.33
AA seq 366 aa AA seqDB search
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRF
DSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQ
RMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQL
RAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLT
WQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEP
SSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDES
LITCKA
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcatggcgccccgagccctcctcctgctgctctcgggaggcctggccctgacc
gagacctgggcctgctcccactccatgaggtatttcgacaccgccgtgtcccggcccggc
cgcggagagccccgcttcatctcagtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccgcgagtccgagaggggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaccgggagacacagaagtacaagcgccaggcacaggctgaccgagtg
agcctgcggaacctgcgcggctactacaaccagagcgaggacgggtctcacaccctccag
aggatgtctggctgcgacctggggcccgacgggcgcctcctccgcgggtatgaccagtcc
gcctacgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgccgcg
gacaccgcggctcagatcacccagcgcaagttggaggcggcccgtgcggcggagcagctg
agagcctacctggagggcacgtgcgtggagtggctccgcagatacctggagaacgggaag
gagacgctgcagcgcgcagaacccccaaagacacacgtgacccaccaccccctctctgac
catgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcacactgacc
tggcagcgggatggggaggaccagacccaggacaccgagcttgtggagaccaggccagca
ggagatggaaccttccagaagtgggcagctgtggtggtgccttctggacaagagcagaga
tacacgtgccatatgcagcacgaggggctgcaagagcccctcaccctgagctgggagcca
tcttcccagcccaccatccccatcatgggcatcgttgctggcctggctgtcctggttgtc
ctagctgtccttggagctgtggtcaccgctatgatgtgtaggaggaagagctcaggtgga
aaaggagggagctgctctcaggctgcgtgcagcaacagtgcccagggctctgatgagtct
ctcatcacttgtaaagcctga

KEGG   Homo sapiens (human): 3133Help
Entry
3133              CDS       T01001                                 

Gene name
HLA-E, HLA-6.2, QA1
Definition
(RefSeq) major histocompatibility complex, class I, E
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3133 (HLA-E)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3133 (HLA-E)
   04145 Phagosome
    3133 (HLA-E)
  09143 Cell growth and death
   04218 Cellular senescence
    3133 (HLA-E)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3133 (HLA-E)
   04612 Antigen processing and presentation
    3133 (HLA-E)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3133 (HLA-E)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3133 (HLA-E)
   05330 Allograft rejection
    3133 (HLA-E)
   05332 Graft-versus-host disease
    3133 (HLA-E)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3133 (HLA-E)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3133 (HLA-E)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3133 (HLA-E)
   05170 Human immunodeficiency virus 1 infection
    3133 (HLA-E)
   05168 Herpes simplex virus 1 infection
    3133 (HLA-E)
   05163 Human cytomegalovirus infection
    3133 (HLA-E)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3133 (HLA-E)
   05169 Epstein-Barr virus infection
    3133 (HLA-E)
   05165 Human papillomavirus infection
    3133 (HLA-E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3133 (HLA-E)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3133 (HLA-E)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3133 (HLA-E)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3133 (HLA-E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 MHC_I_C C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 3133
NCBI-ProteinID: NP_005507
OMIM: 143010
HGNC: 4962
Ensembl: ENSG00000204592
Vega: OTTHUMG00000031155
Pharos: P13747(Tbio)
UniProt: P13747 A0A4E9D3W4 A8K8M6 O19682
LinkDB All DBs
Structure
PDB: 

Position
6p22.1
AA seq 358 aa AA seqDB search
MVDGTLLLLLSEALALTQTWAGSHSLKYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDND
AASPRMVPRAPWMEQEGSEYWDRETRSARDTAQIFRVNLRTLRGYYNQSEAGSHTLQWMH
GCELGPDGRFLRGYEQFAYDGKDYLTLNEDLRSWTAVDTAAQISEQKSNDASEAEHQRAY
LEDTCVEWLHKYLEKGKETLLHLEPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQQ
DGEGHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPVTLRWKPASQ
PTIPIVGIIAGLVLLGSVVSGAVVAAVIWRKKSSGGKGGSYSKAEWSDSAQGSESHSL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggtagatggaaccctccttttactcctctcggaggccctggcccttacccagacctgg
gcgggctcccactccttgaagtatttccacacttccgtgtcccggcccggccgcggggag
ccccgcttcatctctgtgggctacgtggacgacacccagttcgtgcgcttcgacaacgac
gccgcgagtccgaggatggtgccgcgggcgccgtggatggagcaggaggggtcagagtat
tgggaccgggagacacggagcgccagggacaccgcacagattttccgagtgaatctgcgg
acgctgcgcggctactacaatcagagcgaggccgggtctcacaccctgcagtggatgcat
ggctgcgagctggggcccgacgggcgcttcctccgcgggtatgaacagttcgcctacgac
ggcaaggattatctcaccctgaatgaggacctgcgctcctggaccgcggtggacacggcg
gctcagatctccgagcaaaagtcaaatgatgcctctgaggcggagcaccagagagcctac
ctggaagacacatgcgtggagtggctccacaaatacctggagaaggggaaggagacgctg
cttcacctggagcccccaaagacacacgtgactcaccaccccatctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacactgacctggcagcag
gatggggagggccatacccaggacacggagctcgtggagaccaggcctgcaggggatgga
accttccagaagtgggcagctgtggtggtgccttctggagaggagcagagatacacgtgc
catgtgcagcatgaggggctacccgagcccgtcaccctgagatggaagccggcttcccag
cccaccatccccatcgtgggcatcattgctggcctggttctccttggatctgtggtctct
ggagctgtggttgctgctgtgatatggaggaagaagagctcaggtggaaaaggagggagc
tactctaaggctgagtggagcgacagtgcccaggggtctgagtctcacagcttgtaa

KEGG   Homo sapiens (human): 3134Help
Entry
3134              CDS       T01001                                 

Gene name
HLA-F, CDA12, HLA-5.4, HLA-CDA12, HLAF
Definition
(RefSeq) major histocompatibility complex, class I, F
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3134 (HLA-F)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3134 (HLA-F)
   04145 Phagosome
    3134 (HLA-F)
  09143 Cell growth and death
   04218 Cellular senescence
    3134 (HLA-F)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3134 (HLA-F)
   04612 Antigen processing and presentation
    3134 (HLA-F)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3134 (HLA-F)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3134 (HLA-F)
   05330 Allograft rejection
    3134 (HLA-F)
   05332 Graft-versus-host disease
    3134 (HLA-F)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3134 (HLA-F)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3134 (HLA-F)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3134 (HLA-F)
   05170 Human immunodeficiency virus 1 infection
    3134 (HLA-F)
   05168 Herpes simplex virus 1 infection
    3134 (HLA-F)
   05163 Human cytomegalovirus infection
    3134 (HLA-F)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3134 (HLA-F)
   05169 Epstein-Barr virus infection
    3134 (HLA-F)
   05165 Human papillomavirus infection
    3134 (HLA-F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3134 (HLA-F)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3134 (HLA-F)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3134 (HLA-F)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3134 (HLA-F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set Ig_3 MHC_I_3 ig C2-set_2 Ig_2 DUF357 MHC_I_C
Motif
Other DBs
NCBI-GeneID: 3134
NCBI-ProteinID: NP_061823
OMIM: 143110
HGNC: 4963
Ensembl: ENSG00000204642
Vega: OTTHUMG00000031156
Pharos: P30511(Tbio)
UniProt: P30511 Q5JZ47
LinkDB All DBs
Structure
PDB: 

Position
6p22.1
AA seq 346 aa AA seqDB search
MAPRSLLLLLSGALALTDTWAGSHSLRYFSTAVSRPGRGEPRYIAVEYVDDTQFLRFDSD
AAIPRMEPREPWVEQEGPQYWEWTTGYAKANAQTDRVALRNLLRRYNQSEAGSHTLQGMN
GCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADTVAQITQRFYEAEEYAEEFRTY
LEGECLELLRRYLENGKETLQRADPPKAHVAHHPISDHEATLRCWALGFYPAEITLTWQR
DGEEQTQDTELVETRPAGDGTFQKWAAVVVPPGEEQRYTCHVQHEGLPQPLILRWEQSPQ
PTIPIVGIVAGLVVLGAVVTGAVVAAVMWRKKSSDRNRGSYSQAAV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggcgccccgaagcctcctcctgctgctctcaggggccctggccctgaccgatacttgg
gcgggctcccactccttgaggtatttcagcaccgctgtgtcgcggcccggccgcggggag
ccccgctacatcgccgtggagtacgtagacgacacgcaattcctgcggttcgacagcgac
gccgcgattccgaggatggagccgcgggagccgtgggtggagcaagaggggccgcagtat
tgggagtggaccacagggtacgccaaggccaacgcacagactgaccgagtggccctgagg
aacctgctccgccgctacaaccagagcgaggctgggtctcacaccctccagggaatgaat
ggctgcgacatggggcccgacggacgcctcctccgcgggtatcaccagcacgcgtacgac
ggcaaggattacatctccctgaacgaggacctgcgctcctggaccgcggcggacaccgtg
gctcagatcacccagcgcttctatgaggcagaggaatatgcagaggagttcaggacctac
ctggagggcgagtgcctggagttgctccgcagatacttggagaatgggaaggagacgcta
cagcgcgcagatcctccaaaggcacacgttgcccaccaccccatctctgaccatgaggcc
accctgaggtgctgggccctgggcttctaccctgcggagatcacgctgacctggcagcgg
gatggggaggaacagacccaggacacagagcttgtggagaccaggcctgcaggggatgga
accttccagaagtgggccgctgtggtggtgcctcctggagaggaacagagatacacatgc
catgtgcagcacgaggggctgccccagcccctcatcctgagatgggagcagtctccccag
cccaccatccccatcgtgggcatcgttgctggccttgttgtccttggagctgtggtcact
ggagctgtggtcgctgctgtgatgtggaggaagaagagctcagatagaaacagagggagc
tactctcaggctgcagtgtga

KEGG   Homo sapiens (human): 3135Help
Entry
3135              CDS       T01001                                 

Gene name
HLA-G, MHC-G
Definition
(RefSeq) major histocompatibility complex, class I, G
  KO
K06751  MHC class I antigen
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
hsa04145  Phagosome
hsa04218  Cellular senescence
hsa04514  Cell adhesion molecules (CAMs)
hsa04612  Antigen processing and presentation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05203  Viral carcinogenesis
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05416  Viral myocarditis
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00184  KSHV MIR1/2 to antigen processing and presentation by MHC class I molecules
N00363  Antigen processing and presentation by MHC class I molecules
N00364  HPV E5 to antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00418  HCMV US2/11 to antigen processing and presentation by MHC class I molecules
N00419  HCMV US3/10 to antigen processing and presentation by MHC class I molecules
N00461  HIV Nef to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00480  EBV BILF1 to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00344  Leprosy
Drug target
Glatiramer acetate: D04318
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    3135 (HLA-G)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3135 (HLA-G)
   04145 Phagosome
    3135 (HLA-G)
  09143 Cell growth and death
   04218 Cellular senescence
    3135 (HLA-G)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3135 (HLA-G)
   04612 Antigen processing and presentation
    3135 (HLA-G)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    3135 (HLA-G)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3135 (HLA-G)
   05330 Allograft rejection
    3135 (HLA-G)
   05332 Graft-versus-host disease
    3135 (HLA-G)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    3135 (HLA-G)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3135 (HLA-G)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3135 (HLA-G)
   05170 Human immunodeficiency virus 1 infection
    3135 (HLA-G)
   05168 Herpes simplex virus 1 infection
    3135 (HLA-G)
   05163 Human cytomegalovirus infection
    3135 (HLA-G)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3135 (HLA-G)
   05169 Epstein-Barr virus infection
    3135 (HLA-G)
   05165 Human papillomavirus infection
    3135 (HLA-G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3135 (HLA-G)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3135 (HLA-G)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   3135 (HLA-G)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  3135 (HLA-G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_3 Ig_3 C2-set_2 ig SNO
Motif
Other DBs
NCBI-GeneID: 3135
NCBI-ProteinID: NP_002118
OMIM: 142871
HGNC: 4964
Ensembl: ENSG00000204632
Vega: OTTHUMG00000031157
Pharos: P17693(Tbio)
UniProt: P17693 Q6DU14
LinkDB All DBs
Structure
PDB: 

Position
6p22.1
AA seq 338 aa AA seqDB search
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRF
DSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQ
WMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQR
RAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ
SSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcatggcgccccgaaccctcttcctgctgctctcgggggccctgaccctgacc
gagacctgggcgggctcccactccatgaggtatttcagcgccgccgtgtcccggcccggc
cgcggggagccccgcttcatcgccatgggctacgtggacgacacgcagttcgtgcggttc
gacagcgactcggcgtgtccgaggatggagccgcgggcgccgtgggtggagcaggagggg
ccggagtattgggaagaggagacacggaacaccaaggcccacgcacagactgacagaatg
aacctgcagaccctgcgcggctactacaaccagagcgaggccagttctcacaccctccag
tggatgattggctgcgacctggggtccgacggacgcctcctccgcgggtatgaacagtat
gcctacgatggcaaggattacctcgccctgaacgaggacctgcgctcctggaccgcagcg
gacactgcggctcagatctccaagcgcaagtgtgaggcggccaatgtggctgaacaaagg
agagcctacctggagggcacgtgcgtggagtggctccacagatacctggagaacgggaag
gagatgctgcagcgcgcggacccccccaagacacacgtgacccaccaccctgtctttgac
tatgaggccaccctgaggtgctgggccctgggcttctaccctgcggagatcatactgacc
tggcagcgggatggggaggaccagacccaggacgtggagctcgtggagaccaggcctgca
ggggatggaaccttccagaagtgggcagctgtggtggtgccttctggagaggagcagaga
tacacgtgccatgtgcagcatgaggggctgccggagcccctcatgctgagatggaagcag
tcttccctgcccaccatccccatcatgggtatcgttgctggcctggttgtccttgcagct
gtagtcactggagctgcggtcgctgctgtgctgtggagaaagaagagctcagattga

KEGG   Homo sapiens (human): 567Help
Entry
567               CDS       T01001                                 

Gene name
B2M, IMD43
Definition
(RefSeq) beta-2-microglobulin
  KO
K08055  beta-2-microglobulin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06129  MHC presentation (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06229  MHC presentation
  Element
N00363  Antigen processing and presentation by MHC class I molecules
N00417  HCMV US6 to antigen processing and presentation by MHC class I molecules
N00479  EBV BNLF2a to antigen processing and presentation by MHC class I molecules
N00492  HTLV-1 p12 to antigen processing and presentation by MHC class I molecules
N00581  HSV ICP47 to antigen processing and presentation by MHC class I molecules
Disease
H00845  Familial amyloidosis
H01303  Hypercatabolic hypoproteinemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    567 (B2M)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    567 (B2M)
   05170 Human immunodeficiency virus 1 infection
    567 (B2M)
   05168 Herpes simplex virus 1 infection
    567 (B2M)
   05163 Human cytomegalovirus infection
    567 (B2M)
   05169 Epstein-Barr virus infection
    567 (B2M)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    567 (B2M)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   567 (B2M)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C1-set Ig_3 I-set Ig_2
Motif
Other DBs
NCBI-GeneID: 567
NCBI-ProteinID: NP_004039
OMIM: 109700
HGNC: 914
Ensembl: ENSG00000166710
Vega: OTTHUMG00000131247
Pharos: P61769(Tbio)
UniProt: P61769
LinkDB All DBs
Structure
PDB: 
1K5N 3MRE 2YXF 4U1M 3CZF 6MT3 4RMT 3IB4 3SPV 3MRG 3LN4 3D25 3BWA 6MT6 6MTL 2BVP 5C0G 5WL1 4U1J 5N1Y 6P2C 6J2A 5WMQ 4RMU 4RMW 4RAH 4QRS 4QRT 4FXL 3MRB 3MRK 2A83 1OGA 1I4F 4XXC 5IB2 6BXP 1X7Q 5C0F 4RMQ 4RMV 4U6Y 1OGT 6P2F 1XH3 5CFH 5C0E 6J1W 6Q3K 6AT5 5IEH 5DDH 5CSG 4JQV 3VFN 2HJL 2FYY 1ZHL 5C0I 4RMR 5EU5 6MT4 6MT5 5NMH 3VFV 2GTW 1UXS 5NQ3 3QDA 5WMR 6P27 4U1H 6K7T 6P23 6J29 5WMP 5DEF 4QRU 4LCY 4G8I 4G9D 3VRI 3SKO 3PWN 3MYZ 3MRR 3KPM 3GSO 3DX7 3BGM 2V2W 2V2X 2HN7 1ZHK 1M6O 6EI2 5WMO 3V5H 5C0J 6P2S 5VWH 5L2J 4WJ5 4PRN 4PRE 3VFU 3TID 3PWL 3KLA 3FQN 3BH8 2BVO 5NMK 3WL9 3UTQ 5C0D 4U6X 3QFD 5WKE 5T6X 6D64 5XOS 5TXS 5TEZ 5EO0 5E00 5CKA 4RMS 4QRQ 4NO3 4F7T 3VFO 3VCL 3PWJ 3OXR 3O3D 3MRD 3L3I 3KYO 3FQR 3FQX 3DX6 3BH9 2NW3 2GTZ 2GIT 2F8O 2D4F 1ZSD 1SYV 1N2R 5N6B 1UXW 5CSB 5W6A 3D18 6BJ8 5CKG 4PRB 4PRD 3OXS 3BW9 2GT9 2CIK 5T6Y 4U1S 5MEO 4U1N 4I4W 6OPD 1XR9 5VWD 5VWF 5VUE 5GSB 5GRD 5IEK 3X12 3X13 4PR5 4O2C 4HX1 3VXS 3VH8 3SKM 3O3A 3MRC 3LKO 3LKP 3LKQ 3L3D 3GSU 3FT2 3FQT 3FQU 3EKC 3DHM 3BP7 3BO8 3B6S 2Z9T 2H26 2AXF 1TVB 1TVH 1LDS 1I7U 1DUZ 3GSW 5WMN 6D2R 5DEG 4NT6 3KPQ 6C98 5EO1 5ENW 4Z77 4PRA 3VFP 3VFR 3VFS 3O3E 3BP4 2HJK 1JF1 5J1A 5FA3 3BXN 3B3I 5D9S 3MRJ 3C9N 6D29 5MER 4Z76 3H7B 3MYJ 2P5E 6PTE 6D2T 6BJ3 5VUF 5U6Q 5T6W 5HHP 4R9H 4O2F 4NNY 4L4V 4JQX 4JFQ 4G9F 4F7P 3VRJ 3VFM 3T8X 3REW 3O3B 3NA4 3MRM 2X4Q 3LN5 3LKS 3KPP 3GSV 3GJF 3FT4 2H6P 2GUO 2FZ3 1YDP 1T1Z 1M05 1JGD 1HSB 5IB1 5IB3 4X6F 4JFP 4U1I 3MR9 3FQW 5GRG 3LV3 5IB4 4PJE 4M8V 2YPK 3VXN 4E5X 3VFT 3HCV 3GSR 3FT3 2AV1 3KPL 5EU3 5D7J 5C0C 4O2E 6J1V 6C97 6C99 5VWJ 5VUD 5VVP 5V5L 5U98 5WSH 5U16 5T6Z 5GSV 5SWQ 5D7I 3X14 4PJ5 4PJ9 4PJH 3WUW 4NQX 4NO2 3WLB 4LNR 4L4T 4K7F 3V5D 3UPR 3RL1 3MV7 2X70 3LKN 3LKR 3KPN 3HPJ 3H9H 3GIV 3DHJ 3DBX 2AXG 2BVQ 1T1Y 1LP9 1A1N 2CLR 5EU6 5YXN 6AVF 5HHN 5C0B 6D2B 2AV7 1AGD 5WKG 5ISZ 4U1L 1VGK 5HGD 4U1K 6J2E 6GH1 5T70 5HHQ 5EUO 5EOT 5D2N 5CS7 4X6E 4UQ3 4NQE 4NNX 4NO5 3MV8 3MRI 3MRP 2X4U 3L3G 3IXA 3GSX 3DX8 3DTX 2F53 2D4D 1JGE 1AGC 1HSA 5C07 4JFO 5EU4 3GSQ 5IND 5NQ1 6PTB 6AMU 5U17 3X11 1W72 1ONQ 1JHT 1DUY 6GH4 3OX8 2X89 3KWW 1T21 5U2V 5GSR 5HGA 5D5M 4NQD 3MRQ 3MGT 3I6G 3BHB 2P5W 1T1W 1T1X 1T20 1T22 1S9W 1S8D 1OF2 1IM3 1I7R 1E27 1I1Y 1QEW 1AGB 1AGF 3D2U 6APN 1QVO 5TRZ 4PJX 3TIE 1EEY 1GZQ 5MEQ 1W0V 5WWJ 3QFJ 6J2H 6J2I 6EWO 5W67 5WXC 5TS1 5GSD 5B38 5F7D 4Z78 4WU7 4JRX 3VFW 3QDJ 3MRF 3MRN 3MGO 3LOW 2X4O 2X4P 2X4R 2X4T 3KPO 2VLR 2PYE 1XR8 1S9Y 1EEZ 1A1M 1A1O 1AGE 1TMC 6IEX 4WDI 3V5K 5VGD 5C08 2X4N 6D78 4GKS 3MRO 2C7U 6EWA 6AM5 5HGH 4NQV 3RL2 3NFN 6ID4 6CUG 5GR7 5HGB 5FA4 5C9J 5BS0 4WU5 4PJG 4PRI 4MJ5 4LCW 4K71 4HWZ 2YPL 3VXR 4G8G 4F7M 3MRH 3L3J 3KYN 3I6L 2UWE 1SYS 1Q94 1QR1 6J2G 3MRL 4UQ2 4JFF 6G3J 4PJF 3TLR 5JHD 5C0A 4JFD 5C09 4WW2 5IB5 6J2J 6Q3S 6AMT 5WHK 5XS3 5U72 5GSX 5JZI 5IM7 5B39 5HHM 4WO4 4PJ7 4PJC 4PJI 4PRP 4PRH 4NQC 4N8V 3VXM 3VXP 3OV6 3HUJ 3BZE 3BZF 2VLK 2RFX 2DYP 2AK4 1S9X 1R3H 1MI5 1B0G 1BD2 1A9E 1HHI 1HHJ 1HHK 5F9J 5E9D 6GHN 3O4L 2X4S 3BVN 2CII 4L3E 2GJ6 4MJ6 4EN3 5VZ5 3QEQ 6AVG 5VGE 4KDT 3W0W 3UTT 3TO2 2XPG 3M17 3L3K 3KPR 2ESV 1A6Z 1AO7 1HHG 3HLA 2HLA 3VXO 6GL1 5IUE 5BRZ 5IRO 4L3C 1QLF 1AKJ 5XOV 4PJA 3QDG 3PWP 5YXU 5U1R 5FDW 4NO0 4JFE 3VXU 3TM6 3RWJ 3MZT 3MV9 3KPS 3H9S 2NX5 2F74 2F54 1EXU 1QQD 1CG9 5MEP 4ONO 3UTS 6GGM 4MNQ 4FTV 6D7G 5WKI 5NMG 4PJD 5XOT 5WWU 5W69 4X6C 4RA3 4JRY 4I48 3U0P 3QZW 3QDM 3AM8 3JTS 3I6K 3GSN 3FFC 3D3V 2BCK 1ZVS 1XZ0 1GZP 1KPR 1IM9 1I7T 1DE4 1QSE 1QSF 1QRN 1I1F 6EQB 5MEN 3D39 5WJN 5BXF 4PJB 1MHE 4LHU 5V5M 5INC 4EUP 2J8U 5NMF 6G3K 6FGB 4QRP 3HAE 3CIQ 1PY4 1CE6 1B0R 5NME 3VWK 6C09 6AT9 5WKF 5HHO 6DKP 4X6D 4MJI 6MTM 4QRR 4QOK 4HKJ 3HG1 1ZS8 1ZT4 1E28 1EFX 1HHH 4N0F 4WUU 5HYJ 3TZV 4L29 3VWJ 5W1W 4WWK 3W39 3SJV 3M1B 3KXF 1UQS 1KTL 1C16 3SDX 5WJL 6EQA 5WWI 6EWC 5WKH 5NHT 5BJT 5L2K 4GUP 2PO6 2D31 1A9B 6C15 5NQK 6NCA 6AEE 5OPI 5WXD 5KNM 4PJ8 5W1V 6BJ2 6ILM 5D7L 3CDG 1YPZ 1P7Q 5WER 3DXA 1HLA 5D2L 4N0U 6GK3 5E6I 3CII 6ENY 6MPP 2XKS 2XKU 2VLJ 2VLL 2VB5 2E8D 2JCC 2BSR 2BSS 2BST 2BNQ 2BNR 1W0W 1JNJ
Thumbnails

Position
15q21.1
AA seq 119 aa AA seqDB search
MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLL
KNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRDM
NT seq 360 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgctccgtggccttagctgtgctcgcgctactctctctttctggcctggaggct
atccagcgtactccaaagattcaggtttactcacgtcatccagcagagaatggaaagtca
aatttcctgaattgctatgtgtctgggtttcatccatccgacattgaagttgacttactg
aagaatggagagagaattgaaaaagtggagcattcagacttgtctttcagcaaggactgg
tctttctatctcttgtactacactgaattcacccccactgaaaaagatgagtatgcctgc
cgtgtgaaccatgtgactttgtcacagcccaagatagttaagtgggatcgagacatgtaa

DBGET integrated database retrieval system