KEGG   Homo sapiens (human): 3146Help
Entry
3146              CDS       T01001                                 

Gene name
HMGB1, HMG-1, HMG1, HMG3, SBP-1
Definition
(RefSeq) high mobility group box 1
  KO
K10802  high mobility group protein B1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
hsa04140  Autophagy - animal
hsa04217  Necroptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    3146 (HMGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    3146 (HMGB1)
  09143 Cell growth and death
   04217 Necroptosis
    3146 (HMGB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3146 (HMGB1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    3146 (HMGB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3146 (HMGB1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    3146 (HMGB1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     3146 (HMGB1)
   MMR (mismatch excision repair)
    Other MMR factors
     3146 (HMGB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   3146 (HMGB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box HMG_box_2 HMG_box_5 NOA36 Nop14
Motif
Other DBs
NCBI-GeneID: 3146
NCBI-ProteinID: NP_001300821
OMIM: 163905
HGNC: 4983
Ensembl: ENSG00000189403
Vega: OTTHUMG00000016670
Pharos: P09429(Tbio)
UniProt: P09429 A0A024RDR0
LinkDB All DBs
Structure
PDB: 

Position
13q12.3
AA seq 215 aa AA seqDB search
MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKF
EDMAKADKARYEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGL
SIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEK
SKKKKEEEEDEEDEEDEEEEEDEEDEDEEEDDDDE
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaaggagatcctaagaagccgagaggcaaaatgtcatcatatgcattttttgtg
caaacttgtcgggaggagcataagaagaagcacccagatgcttcagtcaacttctcagag
ttttctaagaagtgctcagagaggtggaagaccatgtctgctaaagagaaaggaaaattt
gaagatatggcaaaagcggacaaggcccgttatgaaagagaaatgaaaacctatatccct
cccaaaggggagacaaaaaagaagttcaaggatcccaatgcacccaagaggcctccttcg
gccttcttcctcttctgctctgagtatcgcccaaaaatcaaaggagaacatcctggcctg
tccattggtgatgttgcgaagaaactgggagagatgtggaataacactgctgcagatgac
aagcagccttatgaaaagaaggctgcgaagctgaaggaaaaatacgaaaaggatattgct
gcatatcgagctaaaggaaagcctgatgcagcaaaaaagggagttgtcaaggctgaaaaa
agcaagaaaaagaaggaagaggaggaagatgaggaagatgaagaggatgaggaggaggag
gaagatgaagaagatgaagatgaagaagaagatgatgatgatgaataa

DBGET integrated database retrieval system