KEGG   Homo sapiens (human): 3149
Entry
3149              CDS       T01001                                 

Gene name
HMGB3, HMG-2a, HMG-4, HMG2A, HMG4
Definition
(RefSeq) high mobility group box 3
  KO
K11296  high mobility group protein B3
Organism
hsa  Homo sapiens (human)
Disease
H02170  Microphthalmia, syndromic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3149 (HMGB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3149 (HMGB3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    3149 (HMGB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   3149 (HMGB3)
SSDB
Motif
Pfam: HMG_box_2 HMG_box HMG_box_5 Ribosomal_60s YABBY
Other DBs
NCBI-GeneID: 3149
NCBI-ProteinID: NP_001288157
OMIM: 300193
HGNC: 5004
Ensembl: ENSG00000029993
Vega: OTTHUMG00000024162
Pharos: O15347(Tbio)
UniProt: O15347
LinkDB
Structure
PDB: 
2EQZ 2YQI

Position
Xq28
AA seq 200 aa
MAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKF
DEMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKRPPSGFFLFCSEFRPKIKSTNPGISI
GDVAKKLGEMWNNLNDSEKQPYITKAAKLKEKYEKDVADYKSKGKFDGAKGPAKVARKKV
EEEDEEEEEEEEEEEEEEDE
NT seq 603 nt   +upstreamnt  +downstreamnt
atggctaaaggtgaccccaagaaaccaaagggcaagatgtccgcttatgccttctttgtg
cagacatgcagagaagaacataagaagaaaaacccagaggtccctgtcaattttgcggaa
ttttccaagaagtgctctgagaggtggaagacgatgtccgggaaagagaaatctaaattt
gatgaaatggcaaaggcagataaagtgcgctatgatcgggaaatgaaggattatggacca
gctaagggaggcaagaagaagaaggatcctaatgctcccaaaaggccaccgtctggattc
ttcctgttctgttcagaattccgccccaagatcaaatccacaaaccccggcatctctatt
ggagacgtggcaaaaaagctgggtgagatgtggaataatttaaatgacagtgaaaagcag
ccttacatcactaaggcggcaaagctgaaggagaagtatgagaaggatgttgctgactat
aagtcgaaaggaaagtttgatggtgcaaagggtcctgctaaagttgcccggaaaaaggtg
gaagaggaagatgaagaagaggaggaggaagaagaggaggaggaggaggaggaggatgaa
taa

DBGET integrated database retrieval system