KEGG   Homo sapiens (human): 3161Help
Entry
3161              CDS       T01001                                 

Gene name
HMMR, CD168, IHABP, RHAMM
Definition
(RefSeq) hyaluronan mediated motility receptor
  KO
K06267  hyaluronan-mediated motility receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    3161 (HMMR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3161 (HMMR)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3161 (HMMR)
CD molecules [BR:hsa04090]
 Proteins
  3161 (HMMR)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Hyaluronan
  Cell surface receptors
   3161 (HMMR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMMR_N HMMR_C Uso1_p115_C
Motif
Other DBs
NCBI-GeneID: 3161
NCBI-ProteinID: NP_036616
OMIM: 600936
HGNC: 5012
Ensembl: ENSG00000072571
Vega: OTTHUMG00000130381
Pharos: O75330(Tbio)
UniProt: O75330
LinkDB All DBs
Position
5q34
AA seq 724 aa AA seqDB search
MSFPKAPLKRFNDPSGCAPSPGAYDVKTLEVLKGPVSFQKSQRFKQQKESKQNLNVDKDT
TLPASARKVKSSESKESQKNDKDLKILEKEIRVLLQERGAQDRRIQDLETELEKMEARLN
AALREKTSLSANNATLEKQLIELTRTNELLKSKFSENGNQKNLRILSLELMKLRNKRETK
MRGMMAKQEGMEMKLQVTQRSLEESQGKIAQLEGKLVSIEKEKIDEKSETEKLLEYIEEI
SCASDQVEKYKLDIAQLEENLKEKNDEILSLKQSLEENIVILSKQVEDLNVKCQLLEKEK
EDHVNRNREHNENLNAEMQNLKQKFILEQQEREKLQQKELQIDSLLQQEKELSSSLHQKL
CSFQEEMVKEKNLFEEELKQTLDELDKLQQKEEQAERLVKQLEEEAKSRAEELKLLEEKL
KGKEAELEKSSAAHTQATLLLQEKYDSMVQSLEDVTAQFESYKALTASEIEDLKLENSSL
QEKAAKAGKNAEDVQHQILATESSNQEYVRMLLDLQTKSALKETEIKEITVSFLQKITDL
QNQLKQQEEDFRKQLEDEEGRKAEKENTTAELTEEINKWRLLYEELYNKTKPFQLQLDAF
EVEKQALLNEHGAAQEQLNKIRDSYAKLLGHQNLKQKIKHVVKLKDENSQLKSEVSKLRC
QLAKKKQSETKLQEELNKVLGIKHFDPSKAFHHESKENFALKTPLKEGNTNCYRAPMECQ
ESWK
NT seq 2175 nt NT seq  +upstreamnt  +downstreamnt
atgtcctttcctaaggcgcccttgaaacgattcaatgacccttctggttgtgcaccatct
ccaggtgcttatgatgttaaaactttagaagtattgaaaggaccagtatcctttcagaaa
tcacaaagatttaaacaacaaaaagaatctaaacaaaatcttaatgttgacaaagatact
accttgcctgcttcagctagaaaagttaagtcttcggaatcaaaggaatctcaaaagaat
gataaagatttgaagatattagagaaagagattcgtgttcttctacaggaacgtggtgcc
caggacaggcggatccaggatctggaaactgagttggaaaagatggaagcaaggctaaat
gctgcactaagggaaaaaacatctctctctgcaaataatgctacactggaaaaacaactt
attgaattgaccaggactaatgaactactaaaatctaagttttctgaaaatggtaaccag
aagaatttgagaattctaagcttggagttgatgaaacttagaaacaaaagagaaacaaag
atgaggggtatgatggctaagcaagaaggcatggagatgaagctgcaggtcacccaaagg
agtctcgaagagtctcaagggaaaatagcccaactggagggaaaacttgtttcaatagag
aaagaaaagattgatgaaaaatctgaaacagaaaaactcttggaatacatcgaagaaatt
agttgtgcttcagatcaagtggaaaaatacaagctagatattgcccagttagaagaaaat
ttgaaagagaagaatgatgaaattttaagccttaagcagtctcttgaggagaatattgtt
atattatctaaacaagtagaagatctaaatgtgaaatgtcagctgcttgaaaaagaaaaa
gaagaccatgtcaacaggaatagagaacacaacgaaaatctaaatgcagagatgcaaaac
ttaaaacagaagtttattcttgaacaacaggaacgtgaaaagcttcaacaaaaagaatta
caaattgattcacttctgcaacaagagaaagaattatcttcgagtcttcatcagaagctc
tgttcttttcaagaggaaatggttaaagagaagaatctgtttgaggaagaattaaagcaa
acactggatgagcttgataaattacagcaaaaggaggaacaagctgaaaggctggtcaag
caattggaagaggaagcaaaatctagagctgaagaattaaaactcctagaagaaaagctg
aaagggaaggaggctgaactggagaaaagtagtgctgctcatacccaggccaccctgctt
ttgcaggaaaagtatgacagtatggtgcaaagccttgaagatgttactgctcaatttgaa
agctataaagcgttaacagccagtgagatagaagatcttaagctggagaactcatcatta
caggaaaaagcggccaaggctgggaaaaatgcagaggatgttcagcatcagattttggca
actgagagctcaaatcaagaatatgtaaggatgcttctagatctgcagaccaagtcagca
ctaaaggaaacagaaattaaagaaatcacagtttcttttcttcaaaaaataactgatttg
cagaaccaactcaagcaacaggaggaagactttagaaaacagctggaagatgaagaagga
agaaaagctgaaaaagaaaatacaacagcagaattaactgaagaaattaacaagtggcgt
ctcctctatgaagaactatataataaaacaaaaccttttcagctacaactagatgctttt
gaagtagaaaaacaggcattgttgaatgaacatggtgcagctcaggaacagctaaataaa
ataagagattcatatgctaaattattgggtcatcagaatttgaaacaaaaaatcaagcat
gttgtgaagttgaaagatgaaaatagccaactcaaatcggaagtatcaaaactccgctgt
cagcttgctaaaaaaaaacaaagtgagacaaaacttcaagaggaattgaataaagttcta
ggtatcaaacactttgatccttcaaaggcttttcatcatgaaagtaaagaaaattttgcc
ctgaagaccccattaaaagaaggcaatacaaactgttaccgagctcctatggagtgtcaa
gaatcatggaagtaa

DBGET integrated database retrieval system