KEGG   Homo sapiens (human): 318Help
Entry
318               CDS       T01001                                 

Gene name
NUDT2, APAH1
Definition
(RefSeq) nudix hydrolase 2
  KO
K01518  bis(5'-nucleosidyl)-tetraphosphatase [EC:3.6.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00240  Pyrimidine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    318 (NUDT2)
   00240 Pyrimidine metabolism
    318 (NUDT2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.17  bis(5'-nucleosyl)-tetraphosphatase (asymmetrical)
     318 (NUDT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-GeneID: 318
NCBI-ProteinID: NP_001152
OMIM: 602852
HGNC: 8049
Ensembl: ENSG00000164978
Vega: OTTHUMG00000019817
Pharos: P50583(Tbio)
UniProt: P50583
LinkDB All DBs
Structure
PDB: 

Position
9p13.3
AA seq 147 aa AA seqDB search
MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQ
EEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLE
EACQLAQFKEMKAALQEGHQFLCSIEA
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggccttgagagcatgtggcttgatcatcttccgaagatgcctcattcccaaagtggac
aacaatgcaattgagtttttactgctgcaggcatcagatggcattcatcactggactcct
cccaaaggccatgtggaaccaggagaggatgacttggaaacagccctgagggagacccaa
gaggaagcaggcatagaagcaggccagctgaccattattgaggggttcaaaagggaactc
aattatgtggccaggaacaagcctaaaacagtcatttactggctggcggaggtgaaggac
tatgacgtggagatccgcctctcccatgagcaccaagcctaccgctggctggggctggag
gaggcctgccagttggctcagttcaaggagatgaaggcagcgctccaagaaggacaccag
tttctttgctccatagaggcctga

DBGET integrated database retrieval system