KEGG   Homo sapiens (human): 3195Help
Entry
3195              CDS       T01001                                 

Gene name
TLX1, HOX11, TCL3
Definition
(RefSeq) T cell leukemia homeobox 1
  KO
K09340  T-cell leukemia homeobox protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00144  TLX1 rearrangement to transcriptional repression
Disease
H00002  T-cell acute lymphoblastic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3195 (TLX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3195 (TLX1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, H2.0
    3195 (TLX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homez Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 3195
NCBI-ProteinID: NP_005512
OMIM: 186770
HGNC: 5056
Ensembl: ENSG00000107807
Vega: OTTHUMG00000019341
Pharos: P31314(Tbio)
UniProt: P31314
LinkDB All DBs
Position
10q24.31
AA seq 330 aa AA seqDB search
MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGG
GSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSS
GGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESN
RRYTKDRFTGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKM
TDAQVKTWFQNRRTKWRRQTAEEREAERQQANRILLQLQQEAFQKSLAQPLPADPLCVHN
SSLFALQNLQPWSDDSTKITSVTSVASACE
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggagcacctgggtccgcaccacctccacccgggtcacgcagagcccattagcttcggc
atcgaccagatcctcaacagcccggaccagggtggctgcatgggacccgcctcgcgcctc
caggacggagaatacggccttggctgcttggtcggaggcgcctacacttacggcggcggg
ggctccgcggccgcgacgggggctggaggagcgggggcctatggtactggaggtcccggc
ggccccggaggcccggcaggcggcggcggcgcctgcagcatgggtcctctgaccggctcc
tacaacgtgaacatggccttggcaggcggccccggtcctggcggcggcggcggcagcagc
ggcggtgccggggcactcagcgctgcgggggtaatccgggtgccggcacacaggccgctc
gccggagccgtggcccacccccagcccctggccaccggcttgcccaccgtgccctctgtg
cctgccatgccgggcgtcaacaacctcactggcctcaccttcccctggatggagagtaac
cgcagatacacaaaggacaggttcacaggtcacccctatcagaaccggacgccccccaag
aagaagaagccgcgcacgtccttcacacgcctgcagatctgcgagctggagaagcgcttc
caccgccagaagtacctggcctcggccgagcgcgccgccctggccaaggcgctcaaaatg
accgatgcgcaggtcaaaacctggttccagaaccggcggacaaagtggagacggcagact
gcggaggaacgggaggccgagaggcagcaagcgaaccgcatcctcctgcagttgcagcag
gaggccttccagaagagcctggcacagccgctgcccgctgaccctctgtgcgtgcacaac
tcgtcgctcttcgccctgcagaatctgcagccgtggtctgacgactcgaccaaaatcact
agcgtcacgtcggtggcgtcggcctgcgagtga

DBGET integrated database retrieval system