KEGG   Homo sapiens (human): 3269
Entry
3269              CDS       T01001                                 

Gene name
HRH1, H1-R, H1R, HH1R, hisH1
Definition
(RefSeq) histamine receptor H1
  KO
K04149  histamine receptor H1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Acrivastine: D02760
Alcaftadine: D06552<US>
Alimemazine (DG01101): D02245<JP> D07125
Antazoline (DG01037): D02950 D07458 D07459
Astemizole: D00234
Azatadine (DG01112): D00662 D07482
Azelastine (DG01036): D00659<JP/US> D07483
Bamipine (DG00388): D07197 D07492 D07493
Barmastine: D03056
Bepotastine (DG01327): D01654<JP/US> D09705
Betahistine (DG01004): D01592<JP> D03102 D07522
Bilastine: D09570<JP>
Bisulepin: D07532
Bisulepin hydrochloride: D07533
Broizine: D09838
Bromazine: D03166
Brompheniramine (DG01097): D00663 D07543
Buclizine (DG01104): D02089 D07547
Carbinoxamine (DG01095): D01336<US> D07617 D09808
Cetirizine (DG01107): D00664<JP/US> D07662
Chloropyramine (DG00384): D07195 D07679
Chlorphenamine (DG01099): D00665<JP> D03475 D07398
Chlorphenoxamine (DG00391): D07198 D07684
Chlorpromazine (DG00867): D00270 D00789<JP/US> D03274 D04034<JP> D09819
Cidoxepin hydrochloride: D03491
Cinnarizine (DG01005): D01295 D07734
Clemastine (DG00387): D00666<JP/US> D03535
Closiramine aceturate: D03568
Cycliramine maleate: D03620
Cyclizine (DG01105): D02090 D03621 D03622
Cyproheptadine (DG01109): D02234<JP/US> D07765
Deptropine (DG01114): D07404 D07790
Desloratadine: D03693<JP/US>
Dexbrompheniramine: D03704
Dexchlorpheniramine (DG01098): D00668<JP/US> D07803
Difeterol (DG02077): D01701 D09747 D09748
Dimenhydrinate: D00520<JP/US>
Dimetindene (DG00386): D01343 D07853
Dimetotiazine (DG00843): D01902<JP> D07854
Dioxopromethazine hydrochloride: D07860
Diphenhydramine (DG00390): D00300<JP> D00669<JP/US> D02419 D03285 D03360<JP> D03854
Diphenylimidazole: D02067
Diphenylpyraline (DG01094): D01172 D01627 D07862
Dorastine hydrochloride: D03893
Doxepin (DG00937): D00814<US> D07875
Doxylamine (DG01096): D02327 D07878
Ebastine: D01478<JP>
Efletirizine dihydrochloride: D03963
Embramine: D07889
Emedastine (DG01144): D02249<JP/US> D07890
Epinastine (DG01116): D01713<JP/US> D07900
Esmirtazapine maleate: D04055
Fexofenadine (DG01117): D00671<JP/US> D07958
Histamine: D08040
Histamine phosphate: D04445<US>
Histapyrrodine: D07400
Homochlorcyclizine (DG01328): D01460<JP> D08041
Hydroxyzine (DG00912): D00672<JP/US> D01096<JP/US> D08054
Icotidine: D04494
Isothipendyl (DG00389): D01143 D08091
Ketotifen (DG01115): D01332<JP> D08105
Levocabastine (DG01035): D01717<JP> D08117
Levocetirizine (DG01108): D07402 D08118<JP/US>
Loratadine: D00364<JP>
Mebhydrolin (DG01113): D01786 D08161
Meclozine (DG01106): D01317<US> D08163
Mepyramine (DG00382): D05660 D08183
Mequitazine: D01324<JP>
Methdilazine (DG01103): D04979 D04980
Mizolastine: D01117
Noberastine: D05196
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Olopatadine (DG01039): D01192<JP/US> D08293
Opipramol (DG00930): D01477 D08297
Orphenadrine (DG01252): D08305
Orphenadrine (chloride): D02599
Orphenadrine (citrate): D00774<US>
Oxomemazine: D07401
Phenindamine (DG01110): D02148 D08353
Pheniramine (DG01100): D01174 D08355
Phenyltoloxamine citrate: D08967
Pimethixene: D07406
Promethazine (DG00385): D00480<JP/US> D00494 D01242 D03290<JP> D08432 D08768<JP>
Pyroxamine maleate: D05664
Pyrrobutamine: D07403
Quifenadine: D10230
Rocastine hydrochloride: D05742
Rotoxamine: D05769
Rupatadine (DG01118): D07407 D08497<JP>
Sequifenadine: D10510
Tazifylline hydrochloride: D06012
Tecastemizole: D06021
Temelastine: D06063
Terfenadine: D00521
Tesmilifene hydrochloride: D06084
Thenalidine: D07194
Thonzylamine (DG00381): D01801 D08587
Tolpropamine: D07196
Tripelennamine (DG00383): D02091 D06246 D08645
Triprolidine (DG01111): D01782 D08648
Zolamine hydrochloride: D06376
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3269 (HRH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3269 (HRH1)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3269 (HRH1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3269 (HRH1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    3269 (HRH1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 DUF1601
Other DBs
NCBI-GeneID: 3269
NCBI-ProteinID: NP_000852
OMIM: 600167
HGNC: 5182
Ensembl: ENSG00000196639
Vega: OTTHUMG00000129719
Pharos: P35367(Tclin)
UniProt: P35367
LinkDB
Position
3p25.3
AA seq 487 aa
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
NT seq 1464 nt   +upstreamnt  +downstreamnt
atgagcctccccaattcctcctgcctcttagaagacaagatgtgtgagggcaacaagacc
actatggccagcccccagctgatgcccctggtggtggtcctgagcactatctgcttggtc
acagtagggctcaacctgctggtgctgtatgccgtacggagtgagcggaagctccacact
gtggggaacctgtacatcgtcagcctctcggtggcggacttgatcgtgggtgccgtcgtc
atgcctatgaacatcctctacctgctcatgtccaagtggtcactgggccgtcctctctgc
ctcttttggctttccatggactatgtggccagcacagcgtccattttcagtgtcttcatc
ctgtgcattgatcgctaccgctctgtccagcagcccctcaggtaccttaagtatcgtacc
aagacccgagcctcggccaccattctgggggcctggtttctctcttttctgtgggttatt
cccattctaggctggaatcacttcatgcagcagacctcggtgcgccgagaggacaagtgt
gagacagacttctatgatgtcacctggttcaaggtcatgactgccatcatcaacttctac
ctgcccaccttgctcatgctctggttctatgccaagatctacaaggccgtacgacaacac
tgccagcaccgggagctcatcaataggtccctcccttccttctcagaaattaagctgagg
ccagagaaccccaagggggatgccaagaaaccagggaaggagtctccctgggaggttctg
aaaaggaagccaaaagatgctggtggtggatctgtcttgaagtcaccatcccaaaccccc
aaggagatgaaatccccagttgtcttcagccaagaggatgatagagaagtagacaaactc
tactgctttccacttgatattgtgcacatgcaggctgcggcagaggggagtagcagggac
tatgtagccgtcaaccggagccatggccagctcaagacagatgagcagggcctgaacaca
catggggccagcgagatatcagaggatcagatgttaggtgatagccaatccttctctcga
acggactcagataccaccacagagacagcaccaggcaaaggcaaattgaggagtgggtct
aacacaggcctggattacatcaagtttacttggaagaggctccgctcgcattcaagacag
tatgtatctgggttgcacatgaaccgcgaaaggaaggccgccaaacagttgggttttatc
atggcagccttcatcctctgctggatcccttatttcatcttcttcatggtcattgccttc
tgcaagaactgttgcaatgaacatttgcacatgttcaccatctggctgggctacatcaac
tccacactgaaccccctcatctaccccttgtgcaatgagaacttcaagaagacattcaag
agaattctgcatattcgctcctaa

DBGET integrated database retrieval system