KEGG   Homo sapiens (human): 3270Help
Entry
3270              CDS       T01001                                 

Gene name
HRC
Definition
(RefSeq) histidine rich calcium binding protein
  KO
K23450  sarcoplasmic reticulum histidine-rich calcium-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3270 (HRC)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    3270 (HRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_rich_Ca-bd
Motif
Other DBs
NCBI-GeneID: 3270
NCBI-ProteinID: NP_002143
OMIM: 142705
HGNC: 5178
Ensembl: ENSG00000130528
Vega: OTTHUMG00000183203
Pharos: P23327(Tbio)
UniProt: P23327
LinkDB All DBs
Position
19q13.33
AA seq 699 aa AA seqDB search
MGHHRPWLHASVLWAGVASLLLPPAMTQQLRGDGLGFRNRNNSTGVAGLSEEASAELRHH
LHSPRDHPDENKDVSTENGHHFWSHPDREKEDEDVSKEYGHLLPGHRSQDHKVGDEGVSG
EEVFAEHGGQARGHRGHGSEDTEDSAEHRHHLPSHRSHSHQDEDEDEVVSSEHHHHILRH
GHRGHDGEDDEGEEEEEEEEEEEEASTEYGHQAHRHRGHGSEEDEDVSDGHHHHGPSHRH
QGHEEDDDDDDDDDDDDDDDDVSIEYRHQAHRHQGHGIEEDEDVSDGHHHRDPSHRHRSH
EEDDNDDDDVSTEYGHQAHRHQDHRKEEVEAVSGEHHHHVPDHRHQGHRDEEEDEDVSTE
RWHQGPQHVHHGLVDEEEEEEEITVQFGHYVASHQPRGHKSDEEDFQDEYKTEVPHHHHH
RVPREEDEEVSAELGHQAPSHRQSHQDEETGHGQRGSIKEMSHHPPGHTVVKDRSHLRKD
DSEEEKEKEEDPGSHEEDDESSEQGEKGTHHGSRDQEDEEDEEEGHGLSLNQEEEEEEDK
EEEEEEEDEERREERAEVGAPLSPDHSEEEEEEEEGLEEDEPRFTIIPNPLDRREEAGGA
SSEEESGEDTGPQDAQEYGNYQPGSLCGYCSFCNRCTECESCHCDEENMGEHCDQCQHCQ
FCYLCPLVCETVCAPGSYVDYFSSSLYQALADMLETPEP
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgggccaccataggccatggctgcacgcttctgtcctctgggctggggtggccagcctg
ctcctccccccggccatgacccagcagctcagaggggatgggctaggcttcagaaaccgg
aacaacagcactggagtcgccgggctctccgaggaggcatcagcagagcttcgccaccac
ctccacagccctagagaccatccagatgagaacaaggatgtttccacagagaatgggcat
catttctggagccacccagaccgtgaaaaggaggatgaagatgtctccaaggaatatggg
cacctactcccaggccacaggtcccaagaccacaaagtcggagatgagggtgtctcaggt
gaggaggtctttgcagagcatggtgggcaggcccgtgggcacagaggccacgggagtgaa
gacacggaagactcagctgagcacaggcaccacctccccagccacaggagccacagccat
caagacgaggatgaggatgaagttgtgtccagtgagcatcaccatcatatcctcaggcat
ggacaccgaggccatgatggggaagatgatgaaggagaagaggaggaggaggaggaggag
gaggaagaggaggcctccactgagtatggacaccaggcccacaggcaccgaggccatggg
agtgaagaggatgaggatgtctcagatggacaccatcatcatggccccagccacaggcac
caaggccatgaagaagatgacgatgatgatgatgatgatgatgatgatgatgatgatgat
gatgtctccattgaatatagacaccaggctcacaggcaccaaggccacgggattgaagag
gatgaagatgtctcagatggacaccatcatcgcgaccccagccacaggcaccgaagccat
gaagaagatgacaatgatgatgatgatgtctccactgagtatggacaccaggcccacagg
caccaagaccacagaaaggaagaggttgaggctgtctcaggtgaacaccaccatcatgtc
cctgaccacaggcaccaaggccacagagacgaggaagaagatgaggatgtgtccactgaa
cgttggcaccagggtccccaacatgtccaccatggccttgtagatgaggaagaggaagaa
gaggagatcacagtccagttcggccactatgttgcaagccaccaacctcgaggccacaag
agtgatgaagaggacttccaagatgagtataaaacagaagtccctcaccatcaccaccac
agagtccccagggaggaagatgaggaggtctctgctgagcttggccaccaggcccccagc
cacaggcaaagccaccaagatgaagaaactggccatggtcaaagagggtccatcaaagag
atgagccatcaccccccaggacacacagtggtcaaggatagaagccatttgaggaaggat
gattctgaggaggaaaaggagaaggaagaggaccccggctcccatgaggaagacgatgaa
agttcagagcagggagagaaaggcacccatcatggcagccgggaccaggaagatgaggag
gatgaggaggaaggtcatggcctcagcctgaaccaggaggaggaagaagaggaagacaag
gaggaggaggaggaggaagaagacgaggagaggagggaagagagggctgaggttggggcc
ccactgagcccagaccacagcgaggaggaagaggaggaggaggaggggctggaggaagat
gagccccgcttcaccatcatccccaacccactggacaggagagaggaggctggaggtgcc
tccagcgaggaggaaagcggtgaggacacaggtccacaggatgctcaggagtatgggaac
taccagccagggtccctgtgtggctactgctccttctgcaatcgatgcactgaatgtgag
agctgtcactgtgatgaggagaacatgggtgagcactgcgaccagtgccagcactgtcag
ttctgctatctctgcccgctggtctgcgaaacggtctgcgctccaggaagctacgttgac
tatttctcctcgtccctttatcaggccctggcagacatgctggaaacgccggaaccctga

DBGET integrated database retrieval system