KEGG   Homo sapiens (human): 3270
Entry
3270              CDS       T01001                                 

Gene name
HRC
Definition
(RefSeq) histidine rich calcium binding protein
  KO
K23450  sarcoplasmic reticulum histidine-rich calcium-binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3270 (HRC)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    3270 (HRC)
SSDB
Motif
Pfam: Hist_rich_Ca-bd
Other DBs
NCBI-GeneID: 3270
NCBI-ProteinID: NP_002143
OMIM: 142705
HGNC: 5178
Ensembl: ENSG00000130528
Vega: OTTHUMG00000183203
Pharos: P23327(Tbio)
UniProt: P23327
LinkDB
Position
19q13.33
AA seq 699 aa
MGHHRPWLHASVLWAGVASLLLPPAMTQQLRGDGLGFRNRNNSTGVAGLSEEASAELRHH
LHSPRDHPDENKDVSTENGHHFWSHPDREKEDEDVSKEYGHLLPGHRSQDHKVGDEGVSG
EEVFAEHGGQARGHRGHGSEDTEDSAEHRHHLPSHRSHSHQDEDEDEVVSSEHHHHILRH
GHRGHDGEDDEGEEEEEEEEEEEEASTEYGHQAHRHRGHGSEEDEDVSDGHHHHGPSHRH
QGHEEDDDDDDDDDDDDDDDDVSIEYRHQAHRHQGHGIEEDEDVSDGHHHRDPSHRHRSH
EEDDNDDDDVSTEYGHQAHRHQDHRKEEVEAVSGEHHHHVPDHRHQGHRDEEEDEDVSTE
RWHQGPQHVHHGLVDEEEEEEEITVQFGHYVASHQPRGHKSDEEDFQDEYKTEVPHHHHH
RVPREEDEEVSAELGHQAPSHRQSHQDEETGHGQRGSIKEMSHHPPGHTVVKDRSHLRKD
DSEEEKEKEEDPGSHEEDDESSEQGEKGTHHGSRDQEDEEDEEEGHGLSLNQEEEEEEDK
EEEEEEEDEERREERAEVGAPLSPDHSEEEEEEEEGLEEDEPRFTIIPNPLDRREEAGGA
SSEEESGEDTGPQDAQEYGNYQPGSLCGYCSFCNRCTECESCHCDEENMGEHCDQCQHCQ
FCYLCPLVCETVCAPGSYVDYFSSSLYQALADMLETPEP
NT seq 2100 nt   +upstreamnt  +downstreamnt
atgggccaccataggccatggctgcacgcttctgtcctctgggctggggtggccagcctg
ctcctccccccggccatgacccagcagctcagaggggatgggctaggcttcagaaaccgg
aacaacagcactggagtcgccgggctctccgaggaggcatcagcagagcttcgccaccac
ctccacagccctagagaccatccagatgagaacaaggatgtttccacagagaatgggcat
catttctggagccacccagaccgtgaaaaggaggatgaagatgtctccaaggaatatggg
cacctactcccaggccacaggtcccaagaccacaaagtcggagatgagggtgtctcaggt
gaggaggtctttgcagagcatggtgggcaggcccgtgggcacagaggccacgggagtgaa
gacacggaagactcagctgagcacaggcaccacctccccagccacaggagccacagccat
caagacgaggatgaggatgaagttgtgtccagtgagcatcaccatcatatcctcaggcat
ggacaccgaggccatgatggggaagatgatgaaggagaagaggaggaggaggaggaggag
gaggaagaggaggcctccactgagtatggacaccaggcccacaggcaccgaggccatggg
agtgaagaggatgaggatgtctcagatggacaccatcatcatggccccagccacaggcac
caaggccatgaagaagatgacgatgatgatgatgatgatgatgatgatgatgatgatgat
gatgtctccattgaatatagacaccaggctcacaggcaccaaggccacgggattgaagag
gatgaagatgtctcagatggacaccatcatcgcgaccccagccacaggcaccgaagccat
gaagaagatgacaatgatgatgatgatgtctccactgagtatggacaccaggcccacagg
caccaagaccacagaaaggaagaggttgaggctgtctcaggtgaacaccaccatcatgtc
cctgaccacaggcaccaaggccacagagacgaggaagaagatgaggatgtgtccactgaa
cgttggcaccagggtccccaacatgtccaccatggccttgtagatgaggaagaggaagaa
gaggagatcacagtccagttcggccactatgttgcaagccaccaacctcgaggccacaag
agtgatgaagaggacttccaagatgagtataaaacagaagtccctcaccatcaccaccac
agagtccccagggaggaagatgaggaggtctctgctgagcttggccaccaggcccccagc
cacaggcaaagccaccaagatgaagaaactggccatggtcaaagagggtccatcaaagag
atgagccatcaccccccaggacacacagtggtcaaggatagaagccatttgaggaaggat
gattctgaggaggaaaaggagaaggaagaggaccccggctcccatgaggaagacgatgaa
agttcagagcagggagagaaaggcacccatcatggcagccgggaccaggaagatgaggag
gatgaggaggaaggtcatggcctcagcctgaaccaggaggaggaagaagaggaagacaag
gaggaggaggaggaggaagaagacgaggagaggagggaagagagggctgaggttggggcc
ccactgagcccagaccacagcgaggaggaagaggaggaggaggaggggctggaggaagat
gagccccgcttcaccatcatccccaacccactggacaggagagaggaggctggaggtgcc
tccagcgaggaggaaagcggtgaggacacaggtccacaggatgctcaggagtatgggaac
taccagccagggtccctgtgtggctactgctccttctgcaatcgatgcactgaatgtgag
agctgtcactgtgatgaggagaacatgggtgagcactgcgaccagtgccagcactgtcag
ttctgctatctctgcccgctggtctgcgaaacggtctgcgctccaggaagctacgttgac
tatttctcctcgtccctttatcaggccctggcagacatgctggaaacgccggaaccctga

DBGET integrated database retrieval system