KEGG   Homo sapiens (human): 3276Help
Entry
3276              CDS       T01001                                 

Gene name
PRMT1, ANM1, HCP1, HRMT1L2, IR1B4
Definition
(RefSeq) protein arginine methyltransferase 1
  KO
K11434  type I protein arginine methyltransferase [EC:2.1.1.319]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    3276 (PRMT1)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    3276 (PRMT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3276 (PRMT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.319  type I protein arginine methyltransferase
     3276 (PRMT1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HMTs (histone methyltransferases)
    PRMTs (protein arginine metyltransferases)
     3276 (PRMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Methyltransf_25 PrmA Methyltransf_11 Methyltransf_23 Methyltransf_31 MTS Methyltransf_9 Met_10 DOT1 CMAS PRMT5 PCMT Methyltransf_16 Methyltransf_12 GidB
Motif
Other DBs
NCBI-GeneID: 3276
NCBI-ProteinID: NP_001527
OMIM: 602950
HGNC: 5187
Ensembl: ENSG00000126457
Vega: OTTHUMG00000167568
Pharos: Q99873(Tchem)
UniProt: Q99873
LinkDB All DBs
Structure
PDB: 

Position
19q13.33
AA seq 371 aa AA seqDB search
MAAAEAANCIMENFVATLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHF
GIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECS
SISDYAVKIVKANKLDHVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVLYA
RDKWLAPDGLIFPDRATLYVTAIEDRQYKDYKIHWWENVYGFDMSCIKDVAIKEPLVDVV
DPKQLVTNACLIKEVDIYTVKVEDLTFTSPFCLQVKRNDYVHALVAYFNIEFTRCHKRTG
FSTSPESPYTHWKQTVFYMEDYLTVKTGEEIFGTIGMRPNAKNNRDLDFTIDLDFKGQLC
ELSCSTDYRMR
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atggcggcagccgaggccgcgaactgcatcatggagaattttgtagccaccttggctaat
gggatgagcctccagccgcctcttgaagaagtgtcctgtggccaggcggaaagcagtgag
aagcccaacgctgaggacatgacatccaaagattactactttgactcctacgcacacttt
ggcatccacgaggagatgctgaaggacgaggtgcgcaccctcacttaccgcaactccatg
tttcataaccggcacctcttcaaggacaaggtggtgctggacgtcggctcgggcaccggc
atcctctgcatgtttgctgccaaggccggggcccgcaaggtcatcgggatcgagtgttcc
agtatctctgattatgcggtgaagatcgtcaaagccaacaagttagaccacgtggtgacc
atcatcaaggggaaggtggaggaggtggagctcccagtggagaaggtggacatcatcatc
agcgagtggatgggctactgcctcttctacgagtccatgctcaacaccgtgctctatgcc
cgggacaagtggctggcgcccgatggcctcatcttcccagaccgggccacgctgtatgtg
acggccatcgaggaccggcagtacaaagactacaagatccactggtgggagaacgtgtat
ggcttcgacatgtcttgcatcaaagatgtggccattaaggagcccctagtggatgtcgtg
gaccccaaacagctggtcaccaacgcctgcctcataaaggaggtggacatctataccgtc
aaggtggaagacctgaccttcacctccccgttctgcctgcaagtgaagcggaatgactac
gtgcacgccctggtggcctacttcaacatcgagttcacacgctgccacaagaggaccggc
ttctccaccagccccgagtccccgtacacgcactggaagcagacggtgttctacatggag
gactacctgaccgtgaagacgggcgaggagatcttcggcaccatcggcatgcggcccaac
gccaagaacaaccgggacctggacttcaccatcgacctggacttcaagggccagctgtgc
gagctgtcctgctccaccgactaccggatgcgctga

DBGET integrated database retrieval system