KEGG   Homo sapiens (human): 3280Help
Entry
3280              CDS       T01001                                 

Gene name
HES1, HES-1, HHL, HRY, bHLHb39
Definition
(RefSeq) hes family bHLH transcription factor 1
  KO
K06054  hairy and enhancer of split 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03460  Fanconi anemia pathway
hsa04330  Notch signaling pathway
hsa04950  Maturity onset diabetes of the young
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
nt06116  NOTCH signaling (virus)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00086  Notch signaling pathway
N00087  NOTCH-overexpression to Notch signaling pathway
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
N00380  HPV E6 to Notch signaling pathway
N00381  HPV E6 to Notch signaling pathway
N00382  HPV E6 to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03460 Fanconi anemia pathway
    3280 (HES1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    3280 (HES1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3280 (HES1)
  09162 Cancer: specific types
   05224 Breast cancer
    3280 (HES1)
  09167 Endocrine and metabolic disease
   04950 Maturity onset diabetes of the young
    3280 (HES1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    3280 (HES1)
   05165 Human papillomavirus infection
    3280 (HES1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3280 (HES1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    3280 (HES1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    3280 (HES1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FA core complex binding factors
     3280 (HES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hairy_orange HLH
Motif
Other DBs
NCBI-GeneID: 3280
NCBI-ProteinID: NP_005515
OMIM: 139605
HGNC: 5192
Ensembl: ENSG00000114315
Vega: OTTHUMG00000155984
Pharos: Q14469(Tbio)
UniProt: Q14469
LinkDB All DBs
Structure
PDB: 

Position
3q29
AA seq 280 aa AA seqDB search
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARINESLSQLKTL
ILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAALSTDPSVLGKYRAGFSECMNE
VTRFLSTCEGVNTEVRTRLLGHLANCMTQINAMTYPGQPHPALQAPPPPPPGPGGPQHAP
FAPPPPLVPIPGGAAPPPGGAPCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAH
SGPVIPVYTSNSGTSVGPNAVSPSSGPSLTADSMWRPWRN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgccagctgatataatggagaaaaattcctcgtccccggtggctgctaccccagccagt
gtcaacacgacaccggataaaccaaagacagcatctgagcacagaaagtcatcaaagcct
attatggagaaaagacgaagagcaagaataaatgaaagtctgagccagctgaaaacactg
attttggatgctctgaagaaagatagctcgcggcattccaagctggagaaggcggacatt
ctggaaatgacagtgaagcacctccggaacctgcagcgggcgcagatgacggctgcgctg
agcacagacccaagtgtgctggggaagtaccgagccggcttcagcgagtgcatgaacgag
gtgacccgcttcctgtccacgtgcgagggcgttaataccgaggtgcgcactcggctgctc
ggccacctggccaactgcatgacccagatcaatgccatgacctaccccgggcagccgcac
cccgccttgcaggcgccgccaccgcccccaccgggacccggcggcccccagcacgcgccg
ttcgcgccgccgccgccactcgtgcccatccccgggggcgcggcgccccctcccggcggc
gccccctgcaagctgggcagccaggctggagaggcggctaaggtgtttggaggcttccag
gtggtaccggctcccgatggccagtttgctttcctcattcccaacggggccttcgcgcac
agcggccctgtcatccccgtctacaccagcaacagcggcacctccgtgggccccaacgca
gtgtcaccttccagcggcccctcgcttacggcggactccatgtggaggccgtggcggaac
tga

KEGG   Homo sapiens (human): 388585Help
Entry
388585            CDS       T01001                                 

Gene name
HES5, bHLHb38
Definition
(RefSeq) hes family bHLH transcription factor 5
  KO
K06055  hairy and enhancer of split 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05224  Breast cancer
Network
nt06216  NOTCH signaling
nt06270  Breast cancer
  Element
N00087  NOTCH-overexpression to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    388585 (HES5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    388585 (HES5)
  09162 Cancer: specific types
   05224 Breast cancer
    388585 (HES5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    388585 (HES5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    388585 (HES5)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Hairy, Hairy/E(SPL)
    388585 (HES5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Hairy_orange FancD2
Motif
Other DBs
NCBI-GeneID: 388585
NCBI-ProteinID: NP_001010926
OMIM: 607348
HGNC: 19764
Ensembl: ENSG00000197921
Vega: OTTHUMG00000000793
Pharos: Q5TA89(Tbio)
UniProt: Q5TA89
LinkDB All DBs
Position
1p36.32
AA seq 166 aa AA seqDB search
MAPSTVAVELLSPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKAD
ILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQ
RPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAHQPACGLWRPW
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcccccagcactgtggccgtggagctgctcagccccaaagagaaaaaccgactgcgg
aagccggtggtggagaagatgcgccgcgaccgcatcaacagcagcatcgagcagctgaag
ctgctgctggagcaggagttcgcgcggcaccagcccaactccaagctggagaaggccgac
atcctggagatggctgtcagctacctgaagcacagcaaagccttcgtcgccgccgccggc
cccaagagcctgcaccaggactacagcgaaggctactcgtggtgcctgcaggaggccgtg
cagttcctgacgctccacgccgccagcgacacgcagatgaagctgctgtaccacttccag
cggcccccggccgcgcccgccgcgcccgccaaggagcccaaggcgccgggcgccgcgccc
ccgcccgcgctctccgccaaggccaccgccgccgccgccgccgcgcaccagcccgcctgc
ggcctctggcggccctggtga

DBGET integrated database retrieval system