KEGG   Homo sapiens (human): 329
Entry
329               CDS       T01001                                 

Gene name
BIRC2, API1, HIAP2, Hiap-2, MIHB, RNF48, c-IAP1, cIAP1
Definition
(RefSeq) baculoviral IAP repeat containing 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05132  Salmonella infection
hsa05145  Toxoplasmosis
hsa05168  Herpes simplex virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05222  Small cell lung cancer
Network
nt06123  TNF signaling (viruses and bacteria)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
  Element
N00560  HSV gD to HVEM-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    329 (BIRC2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    329 (BIRC2)
   04064 NF-kappa B signaling pathway
    329 (BIRC2)
   04668 TNF signaling pathway
    329 (BIRC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    329 (BIRC2)
   04215 Apoptosis - multiple species
    329 (BIRC2)
   04217 Necroptosis
    329 (BIRC2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    329 (BIRC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    329 (BIRC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    329 (BIRC2)
   05202 Transcriptional misregulation in cancer
    329 (BIRC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    329 (BIRC2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    329 (BIRC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    329 (BIRC2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    329 (BIRC2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    329 (BIRC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    329 (BIRC2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    329 (BIRC2)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I32: IAP family
   329 (BIRC2)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    329 (BIRC2)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-C3HC4_2 zf-RING_5 DUF2039 NikR_C zf-RING_UBOX
Other DBs
NCBI-GeneID: 329
NCBI-ProteinID: NP_001157
OMIM: 601712
HGNC: 590
Ensembl: ENSG00000110330
Vega: OTTHUMG00000167325
Pharos: Q13490(Tchem)
UniProt: Q13490
LinkDB
Structure
PDB: 

Position
11q22.2
AA seq 618 aa
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgcacaaaactgcctcccaaagacttttcccaggtccctcgtatcaaaacattaagagt
ataatggaagatagcacgatcttgtcagattggacaaacagcaacaaacaaaaaatgaag
tatgacttttcctgtgaactctacagaatgtctacatattcaactttccccgccggggtg
cctgtctcagaaaggagtcttgctcgtgctggtttttattatactggtgtgaatgacaag
gtcaaatgcttctgttgtggcctgatgctggataactggaaactaggagacagtcctatt
caaaagcataaacagctatatcctagctgtagctttattcagaatctggtttcagctagt
ctgggatccacctctaagaatacgtctccaatgagaaacagttttgcacattcattatct
cccaccttggaacatagtagcttgttcagtggttcttactccagcctttctccaaaccct
cttaattctagagcagttgaagacatctcttcatcgaggactaacccctacagttatgca
atgagtactgaagaagccagatttcttacctaccatatgtggccattaacttttttgtca
ccatcagaattggcaagagctggtttttattatataggacctggagatagggtagcctgc
tttgcctgtggtgggaagctcagtaactgggaaccaaaggatgatgctatgtcagaacac
cggaggcattttcccaactgtccatttttggaaaattctctagaaactctgaggtttagc
atttcaaatctgagcatgcagacacatgcagctcgaatgagaacatttatgtactggcca
tctagtgttccagttcagcctgagcagcttgcaagtgctggtttttattatgtgggtcgc
aatgatgatgtcaaatgcttttgttgtgatggtggcttgaggtgttgggaatctggagat
gatccatgggtagaacatgccaagtggtttccaaggtgtgagttcttgatacgaatgaaa
ggccaagagtttgttgatgagattcaaggtagatatcctcatcttcttgaacagctgttg
tcaacttcagataccactggagaagaaaatgctgacccaccaattattcattttggacct
ggagaaagttcttcagaagatgctgtcatgatgaatacacctgtggttaaatctgccttg
gaaatgggctttaatagagacctggtgaaacaaacagttcaaagtaaaatcctgacaact
ggagagaactataaaacagttaatgatattgtgtcagcacttcttaatgctgaagatgaa
aaaagagaagaggagaaggaaaaacaagctgaagaaatggcatcagatgatttgtcatta
attcggaagaacagaatggctctctttcaacaattgacatgtgtgcttcctatcctggat
aatcttttaaaggccaatgtaattaataaacaggaacatgatattattaaacaaaaaaca
cagatacctttacaagcgagagaactgattgataccattttggttaaaggaaatgctgcg
gccaacatcttcaaaaactgtctaaaagaaattgactctacattgtataagaacttattt
gtggataagaatatgaagtatattccaacagaagatgtttcaggtctgtcactggaagaa
caattgaggaggttgcaagaagaacgaacttgtaaagtgtgtatggacaaagaagtttct
gttgtatttattccttgtggtcatctggtagtatgccaggaatgtgccccttctctaaga
aaatgccctatttgcaggggtataatcaagggtactgttcgtacatttctctcttaa

KEGG   Homo sapiens (human): 330
Entry
330               CDS       T01001                                 

Gene name
BIRC3, AIP1, API2, CIAP2, HAIP1, HIAP1, IAP-1, MALT2, MIHC, RNF49, c-IAP2
Definition
(RefSeq) baculoviral IAP repeat containing 3
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04064  NF-kappa B signaling pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04217  Necroptosis
hsa04390  Hippo signaling pathway
hsa04510  Focal adhesion
hsa04621  NOD-like receptor signaling pathway
hsa04668  TNF signaling pathway
hsa05132  Salmonella infection
hsa05145  Toxoplasmosis
hsa05168  Herpes simplex virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05222  Small cell lung cancer
Network
nt06123  TNF signaling (viruses and bacteria)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06240  Transcription
  Element
N00123  Amplified REL to transcription
N00560  HSV gD to HVEM-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    330 (BIRC3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    330 (BIRC3)
   04064 NF-kappa B signaling pathway
    330 (BIRC3)
   04668 TNF signaling pathway
    330 (BIRC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    330 (BIRC3)
   04215 Apoptosis - multiple species
    330 (BIRC3)
   04217 Necroptosis
    330 (BIRC3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    330 (BIRC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    330 (BIRC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    330 (BIRC3)
   05202 Transcriptional misregulation in cancer
    330 (BIRC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    330 (BIRC3)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    330 (BIRC3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    330 (BIRC3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    330 (BIRC3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    330 (BIRC3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    330 (BIRC3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    330 (BIRC3)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I32: IAP family
   330 (BIRC3)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    330 (BIRC3)
SSDB
Motif
Pfam: BIR CARD zf-C3HC4_3 Prok-RING_4 zf-RING_5 OTT_1508_deam zf-C3HC4_2 DUF2039 zf-RING_UBOX
Other DBs
NCBI-GeneID: 330
NCBI-ProteinID: NP_001156
OMIM: 601721
HGNC: 591
Ensembl: ENSG00000023445
Vega: OTTHUMG00000167324
Pharos: Q13489(Tchem)
UniProt: Q13489
LinkDB
Structure
PDB: 
2UVL 3EB5 3M0A 3M0D 3EB6

Position
11q22.2
AA seq 604 aa
MNIVENSIFLSNLMKSANTFELKYDLSCELYRMSTYSTFPAGVPVSERSLARAGFYYTGV
NDKVKCFCCGLMLDNWKRGDSPTEKHKKLYPSCRFVQSLNSVNNLEATSQPTFPSSVTNS
THSLLPGTENSGYFRGSYSNSPSNPVNSRANQDFSALMRSSYHCAMNNENARLLTFQTWP
LTFLSPTDLAKAGFYYIGPGDRVACFACGGKLSNWEPKDNAMSEHLRHFPKCPFIENQLQ
DTSRYTVSNLSMQTHAARFKTFFNWPSSVLVNPEQLASAGFYYVGNSDDVKCFCCDGGLR
CWESGDDPWVQHAKWFPRCEYLIRIKGQEFIRQVQASYPHLLEQLLSTSDSPGDENAESS
IIHFEPGEDHSEDAIMMNTPVINAAVEMGFSRSLVKQTVQRKILATGENYRLVNDLVLDL
LNAEDEIREEERERATEEKESNDLLLIRKNRMALFQHLTCVIPILDSLLTAGIINEQEHD
VIKQKTQTSLQARELIDTILVKGNIAATVFRNSLQEAEAVLYEHLFVQQDIKYIPTEDVS
DLPVEEQLRRLQEERTCKVCMDKEVSIVFIPCGHLVVCKDCAPSLRKCPICRSTIKGTVR
TFLS
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgaacatagtagaaaacagcatattcttatcaaatttgatgaaaagcgccaacacgttt
gaactgaaatacgacttgtcatgtgaactgtaccgaatgtctacgtattccacttttcct
gctggggttcctgtctcagaaaggagtcttgctcgtgctggtttctattacactggtgtg
aatgacaaggtcaaatgcttctgttgtggcctgatgctggataactggaaaagaggagac
agtcctactgaaaagcataaaaagttgtatcctagctgcagattcgttcagagtctaaat
tccgttaacaacttggaagctacctctcagcctacttttccttcttcagtaacaaattcc
acacactcattacttccgggtacagaaaacagtggatatttccgtggctcttattcaaac
tctccatcaaatcctgtaaactccagagcaaatcaagatttttctgccttgatgagaagt
tcctaccactgtgcaatgaataacgaaaatgccagattacttacttttcagacatggcca
ttgacttttctgtcgccaacagatctggcaaaagcaggcttttactacataggacctgga
gacagagtggcttgctttgcctgtggtggaaaattgagcaattgggaaccgaaggataat
gctatgtcagaacacctgagacattttcccaaatgcccatttatagaaaatcagcttcaa
gacacttcaagatacacagtttctaatctgagcatgcagacacatgcagcccgctttaaa
acattctttaactggccctctagtgttctagttaatcctgagcagcttgcaagtgcgggt
ttttattatgtgggtaacagtgatgatgtcaaatgcttttgctgtgatggtggactcagg
tgttgggaatctggagatgatccatgggttcaacatgccaagtggtttccaaggtgtgag
tacttgataagaattaaaggacaggagttcatccgtcaagttcaagccagttaccctcat
ctacttgaacagctgctatccacatcagacagcccaggagatgaaaatgcagagtcatca
attatccattttgaacctggagaagaccattcagaagatgcaatcatgatgaatactcct
gtgattaatgctgccgtggaaatgggctttagtagaagcctggtaaaacagacagttcag
agaaaaatcctagcaactggagagaattatagactagtcaatgatcttgtgttagactta
ctcaatgcagaagatgaaataagggaagaggagagagaaagagcaactgaggaaaaagaa
tcaaatgatttattattaatccggaagaatagaatggcactttttcaacatttgacttgt
gtaattccaatcctggatagtctactaactgccggaattattaatgaacaagaacatgat
gttattaaacagaagacacagacgtctttacaagcaagagaactgattgatacgatttta
gtaaaaggaaatattgcagccactgtattcagaaactctctgcaagaagctgaagctgtg
ttatatgagcatttatttgtgcaacaggacataaaatatattcccacagaagatgtttca
gatctaccagtggaagaacaattgcggagactacaagaagaaagaacatgtaaagtgtgt
atggacaaagaagtgtccatagtgtttattccttgtggtcatctagtagtatgcaaagat
tgtgctccttctttaagaaagtgtcctatttgtaggagtacaatcaagggtacagttcgt
acatttctttcatga

KEGG   Homo sapiens (human): 4790
Entry
4790              CDS       T01001                                 

Gene name
NFKB1, CVID12, EBP-1, KBF1, NF-kB, NF-kB1, NF-kappa-B1, NF-kappaB, NF-kappabeta, NFKB-p105, NFKB-p50, NFkappaB
Definition
(RefSeq) nuclear factor kappa B subunit 1
  KO
K02580  nuclear factor NF-kappa-B p105 subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05030  Cocaine addiction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05212  Pancreatic cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05321  Inflammatory bowel disease
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06114  PI3K signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06139  NLR signaling (viruses and bacteria)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06214  PI3K signaling
nt06223  TNF signaling
nt06224  CXCR signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06417  AGE-RAGE signaling
nt06460  Alzheimer disease
  Element
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to TNF-NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00269  HCV core to TNF-NFKB signaling pathway
N00389  HCMV IE1-72 to transcription
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00391  HCMV gB to EGFR-PI3K-NFKB signaling pathway
N00398  HCMV IE2-86 to TNF-NFKB signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00443  HIV Vpr/Nef/Tat to TNF-NFKB signaling pathway
N00501  HTLV-1 Tax to EGFR-PI3K-NFKB signaling pathway
N00504  HTLV-1 Tax to NFKB signaling pathway
N00550  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00559  LIGHT-HVEM-NFKB signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
N00563  TLR3-NFKB signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
N00932  Escherichia NleH1 to TNF-NFKB signaling pathway
N00940  NOD-NFKB signaling pathway
N00994  AGE-RAGE signaling pathway
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
N01112  Salmonella SopE/E2 to NOD-NFKB signaling pathway
N01115  Salmonella SseL to TNF-NFKB signaling pathway
N01118  Salmonella SpvD to TNF-NFKB signaling pathway
Disease
H00088  Common variable immunodeficiency
Drug target
Iguratimod: D01146<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4790 (NFKB1)
   04014 Ras signaling pathway
    4790 (NFKB1)
   04064 NF-kappa B signaling pathway
    4790 (NFKB1)
   04668 TNF signaling pathway
    4790 (NFKB1)
   04066 HIF-1 signaling pathway
    4790 (NFKB1)
   04071 Sphingolipid signaling pathway
    4790 (NFKB1)
   04024 cAMP signaling pathway
    4790 (NFKB1)
   04151 PI3K-Akt signaling pathway
    4790 (NFKB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    4790 (NFKB1)
   04218 Cellular senescence
    4790 (NFKB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    4790 (NFKB1)
   04621 NOD-like receptor signaling pathway
    4790 (NFKB1)
   04622 RIG-I-like receptor signaling pathway
    4790 (NFKB1)
   04623 Cytosolic DNA-sensing pathway
    4790 (NFKB1)
   04625 C-type lectin receptor signaling pathway
    4790 (NFKB1)
   04660 T cell receptor signaling pathway
    4790 (NFKB1)
   04658 Th1 and Th2 cell differentiation
    4790 (NFKB1)
   04659 Th17 cell differentiation
    4790 (NFKB1)
   04657 IL-17 signaling pathway
    4790 (NFKB1)
   04662 B cell receptor signaling pathway
    4790 (NFKB1)
   04062 Chemokine signaling pathway
    4790 (NFKB1)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    4790 (NFKB1)
   04917 Prolactin signaling pathway
    4790 (NFKB1)
   04926 Relaxin signaling pathway
    4790 (NFKB1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    4790 (NFKB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    4790 (NFKB1)
  09149 Aging
   04211 Longevity regulating pathway
    4790 (NFKB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4790 (NFKB1)
   05202 Transcriptional misregulation in cancer
    4790 (NFKB1)
   05206 MicroRNAs in cancer
    4790 (NFKB1)
   05203 Viral carcinogenesis
    4790 (NFKB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    4790 (NFKB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    4790 (NFKB1)
   05221 Acute myeloid leukemia
    4790 (NFKB1)
   05220 Chronic myeloid leukemia
    4790 (NFKB1)
   05215 Prostate cancer
    4790 (NFKB1)
   05222 Small cell lung cancer
    4790 (NFKB1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    4790 (NFKB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4790 (NFKB1)
   05022 Pathways of neurodegeneration - multiple diseases
    4790 (NFKB1)
  09165 Substance dependence
   05030 Cocaine addiction
    4790 (NFKB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4790 (NFKB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    4790 (NFKB1)
   04931 Insulin resistance
    4790 (NFKB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    4790 (NFKB1)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    4790 (NFKB1)
   05130 Pathogenic Escherichia coli infection
    4790 (NFKB1)
   05132 Salmonella infection
    4790 (NFKB1)
   05131 Shigellosis
    4790 (NFKB1)
   05135 Yersinia infection
    4790 (NFKB1)
   05133 Pertussis
    4790 (NFKB1)
   05134 Legionellosis
    4790 (NFKB1)
   05152 Tuberculosis
    4790 (NFKB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4790 (NFKB1)
   05170 Human immunodeficiency virus 1 infection
    4790 (NFKB1)
   05162 Measles
    4790 (NFKB1)
   05164 Influenza A
    4790 (NFKB1)
   05161 Hepatitis B
    4790 (NFKB1)
   05160 Hepatitis C
    4790 (NFKB1)
   05168 Herpes simplex virus 1 infection
    4790 (NFKB1)
   05163 Human cytomegalovirus infection
    4790 (NFKB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4790 (NFKB1)
   05169 Epstein-Barr virus infection
    4790 (NFKB1)
   05165 Human papillomavirus infection
    4790 (NFKB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    4790 (NFKB1)
   05145 Toxoplasmosis
    4790 (NFKB1)
   05140 Leishmaniasis
    4790 (NFKB1)
   05142 Chagas disease
    4790 (NFKB1)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    4790 (NFKB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4790 (NFKB1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    4790 (NFKB1)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank_4 Ank Ank_3 Ank_5 Death
Other DBs
NCBI-GeneID: 4790
NCBI-ProteinID: NP_001158884
OMIM: 164011
HGNC: 7794
Ensembl: ENSG00000109320
Vega: OTTHUMG00000161080
Pharos: P19838(Tchem)
UniProt: P19838
LinkDB
Structure
PDB: 
1SVC 1NFI 2O61 3GUT 2DBF

Position
4q24
AA seq 968 aa
MAEDDPYLGRPEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV
CEGPSHGGLPGASSEKNKKSYPQVKICNYVGPAKVIVQLVTNGKNIHLHAHSLVGKHCED
GICTVTAGPKDMVVGFANLGILHVTKKKVFETLEARMTEACIRGYNPGLLVHPDLAYLQA
EGGGDRQLGDREKELIRQAALQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEENGGVWEGFGDF
SPTDVHRQFAIVFKTPKYKDINITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQ
RKRQKLMPNFSDSFGGGSGAGAGGGGMFGSGGGGGGTGSTGPGYSFPHYGFPTYGGITFH
PGTTKSNAGMKHGTMDTESKKDPEGCDKSDDKNTVNLFGKVIETTEQDQEPSEATVGNGE
VTLTYATGTKEESAGVQDNLFLEKAMQLAKRHANALFDYAVTGDVKMLLAVQRHLTAVQD
ENGDSVLHLAIIHLHSQLVRDLLEVTSGLISDDIINMRNDLYQTPLHLAVITKQEDVVED
LLRAGADLSLLDRLGNSVLHLAAKEGHDKVLSILLKHKKAALLLDHPNGDGLNAIHLAMM
SNSLPCLLLLVAAGADVNAQEQKSGRTALHLAVEHDNISLAGCLLLEGDAHVDSTTYDGT
TPLHIAAGRGSTRLAALLKAAGADPLVENFEPLYDLDDSWENAGEDEGVVPGTTPLDMAT
SWQVFDILNGKPYEPEFTSDDLLAQGDMKQLAEDVKLQLYKLLEIPDPDKNWATLAQKLG
LGILNNAFRLSPAPSKTLMDNYEVSGGTVRELVEALRQMGYTEAIEVIQAASSPVKTTSQ
AHSLPLSPASTRQQIDELRDSDSVCDSGVETSFRKLSFTESLTSGASLLTLNKMPHDYGQ
EGPLEGKI
NT seq 2907 nt   +upstreamnt  +downstreamnt
atggcagaagatgatccatatttgggaaggcctgaacaaatgtttcatttggatccttct
ttgactcatacaatatttaatccagaagtatttcaaccacagatggcactgccaacagat
ggcccataccttcaaatattagagcaacctaaacagagaggatttcgtttccgttatgta
tgtgaaggcccatcccatggtggactacctggtgcctctagtgaaaagaacaagaagtct
taccctcaggtcaaaatctgcaactatgtgggaccagcaaaggttattgttcagttggtc
acaaatggaaaaaatatccacctgcatgcccacagcctggtgggaaaacactgtgaggat
gggatctgcactgtaactgctggacccaaggacatggtggtcggcttcgcaaacctgggt
atacttcatgtgacaaagaaaaaagtatttgaaacactggaagcacgaatgacagaggcg
tgtataaggggctataatcctggactcttggtgcaccctgaccttgcctatttgcaagca
gaaggtggaggggaccggcagctgggagatcgggaaaaagagctaatccgccaagcagct
ctgcagcagaccaaggagatggacctcagcgtggtgcggctcatgtttacagcttttctt
ccggatagcactggcagcttcacaaggcgcctggaacccgtggtatcagacgccatctat
gacagtaaagcccccaatgcatccaacttgaaaattgtaagaatggacaggacagctgga
tgtgtgactggaggggaggaaatttatcttctttgtgacaaagttcagaaagatgacatc
cagattcgattttatgaagaggaagaaaatggtggagtctgggaaggatttggagatttt
tcccccacagatgttcatagacaatttgccattgtcttcaaaactccaaagtataaagat
attaatattacaaaaccagcctctgtgtttgtccagcttcggaggaaatctgacttggaa
actagtgaaccaaaacctttcctctactatcctgaaatcaaagataaagaagaagtgcag
aggaaacgtcagaagctcatgcccaatttttcggatagtttcggcggtggtagtggtgct
ggagctggaggcggaggcatgtttggtagtggcggtggaggagggggcactggaagtaca
ggtccagggtatagcttcccacactatggatttcctacttatggtgggattactttccat
cctggaactactaaatctaatgctgggatgaagcatggaaccatggacactgaatctaaa
aaggaccctgaaggttgtgacaaaagtgatgacaaaaacactgtaaacctctttgggaaa
gttattgaaaccacagagcaagatcaggagcccagcgaggccaccgttgggaatggtgag
gtcactctaacgtatgcaacaggaacaaaagaagagagtgctggagttcaggataacctc
tttctagagaaggctatgcagcttgcaaagaggcatgccaatgcccttttcgactacgcg
gtgacaggagacgtgaagatgctgctggccgtccagcgccatctcactgctgtgcaggat
gagaatggggacagtgtcttacacttagcaatcatccaccttcattctcaacttgtgagg
gatctactagaagtcacatctggtttgatttctgatgacattatcaacatgagaaatgat
ctgtaccagacgcccttgcacttggcagtgatcactaagcaggaagatgtggtggaggat
ttgctgagggctggggccgacctgagccttctggaccgcttgggtaactctgttttgcac
ctagctgccaaagaaggacatgataaagttctcagtatcttactcaagcacaaaaaggca
gcactacttcttgaccaccccaacggggacggtctgaatgccattcatctagccatgatg
agcaatagcctgccatgtttgctgctgctggtggccgctggggctgacgtcaatgctcag
gagcagaagtccgggcgcacagcactgcacctggctgtggagcacgacaacatctcattg
gcaggctgcctgctcctggagggtgatgcccatgtggacagtactacctacgatggaacc
acacccctgcatatagcagctgggagagggtccaccaggctggcagctcttctcaaagca
gcaggagcagatcccctggtggagaactttgagcctctctatgacctggatgactcttgg
gaaaatgcaggagaggatgaaggagttgtgcctggaaccacgcctctagatatggccacc
agctggcaggtatttgacatattaaatgggaaaccatatgagccagagtttacatctgat
gatttactagcacaaggagacatgaaacagctggctgaagatgtgaagctgcagctgtat
aagttactagaaattcctgatccagacaaaaactgggctactctggcgcagaaattaggt
ctggggatacttaataatgccttccggctgagtcctgctccttccaaaacacttatggac
aactatgaggtctctgggggtacagtcagagagctggtggaggccctgagacaaatgggc
tacaccgaagcaattgaagtgatccaggcagcctccagcccagtgaagaccacctctcag
gcccactcgctgcctctctcgcctgcctccacaaggcagcaaatagacgagctccgagac
agtgacagtgtctgcgacagcggcgtggagacatccttccgcaaactcagctttaccgag
tctctgaccagtggtgcctcactgctaactctcaacaaaatgccccatgattatgggcag
gaaggacctctagaaggcaaaatttag

KEGG   Homo sapiens (human): 5970
Entry
5970              CDS       T01001                                 

Gene name
RELA, CMCU, NFKB3, p65
Definition
(RefSeq) RELA proto-oncogene, NF-kB subunit
  KO
K04735  transcription factor p65
Organism
hsa  Homo sapiens (human)
Pathway
hsa01523  Antifolate resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04137  Mitophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04211  Longevity regulating pathway
hsa04218  Cellular senescence
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04668  TNF signaling pathway
hsa04722  Neurotrophin signaling pathway
hsa04917  Prolactin signaling pathway
hsa04920  Adipocytokine signaling pathway
hsa04926  Relaxin signaling pathway
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05030  Cocaine addiction
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05130  Pathogenic Escherichia coli infection
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05212  Pancreatic cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05321  Inflammatory bowel disease
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06114  PI3K signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06133  RIG-I signaling (viruses)
nt06139  NLR signaling (viruses and bacteria)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06214  PI3K signaling
nt06223  TNF signaling
nt06224  CXCR signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06417  AGE-RAGE signaling
nt06460  Alzheimer disease
  Element
N00140  FUS-DDIT3 fusion to NFKB-mediated transcription
N00151  TNF-NFKB signaling pathway
N00171  KSHV vFLIP to NFKB signaling pathway
N00173  KSHV K15 to TNF-NFKB signaling pathway
N00174  KSHV vFLIP to TNF-NFKB signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00265  EBV LMP1 to NFKB signaling pathway
N00269  HCV core to TNF-NFKB signaling pathway
N00389  HCMV IE1-72 to transcription
N00390  EGF-EGFR-PI3K-NFKB signaling pathway
N00391  HCMV gB to EGFR-PI3K-NFKB signaling pathway
N00398  HCMV IE2-86 to TNF-NFKB signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00441  HIV gp120 to TNF-NFKB signaling pathway
N00442  HIV Nef to TNF-NFKB signaling pathway
N00443  HIV Vpr/Nef/Tat to TNF-NFKB signaling pathway
N00501  HTLV-1 Tax to EGFR-PI3K-NFKB signaling pathway
N00504  HTLV-1 Tax to NFKB signaling pathway
N00550  HBV HBeAg to TLR2/4-NFKB signaling pathway
N00559  LIGHT-HVEM-NFKB signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
N00563  TLR3-NFKB signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
N00929  Escherichia NleC to TNF-NFKB signaling pathway
N00932  Escherichia NleH1 to TNF-NFKB signaling pathway
N00940  NOD-NFKB signaling pathway
N00943  Shigella IpaH4.5 to TNF-NFKB signaling pathway
N00994  AGE-RAGE signaling pathway
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
N01112  Salmonella SopE/E2 to NOD-NFKB signaling pathway
N01115  Salmonella SseL to TNF-NFKB signaling pathway
N01118  Salmonella SpvD to TNF-NFKB signaling pathway
N01122  Salmonella PipA/GogA/GtgA to TNF-NFKB signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5970 (RELA)
   04014 Ras signaling pathway
    5970 (RELA)
   04064 NF-kappa B signaling pathway
    5970 (RELA)
   04668 TNF signaling pathway
    5970 (RELA)
   04066 HIF-1 signaling pathway
    5970 (RELA)
   04071 Sphingolipid signaling pathway
    5970 (RELA)
   04024 cAMP signaling pathway
    5970 (RELA)
   04151 PI3K-Akt signaling pathway
    5970 (RELA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    5970 (RELA)
  09143 Cell growth and death
   04210 Apoptosis
    5970 (RELA)
   04218 Cellular senescence
    5970 (RELA)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    5970 (RELA)
   04621 NOD-like receptor signaling pathway
    5970 (RELA)
   04622 RIG-I-like receptor signaling pathway
    5970 (RELA)
   04623 Cytosolic DNA-sensing pathway
    5970 (RELA)
   04625 C-type lectin receptor signaling pathway
    5970 (RELA)
   04660 T cell receptor signaling pathway
    5970 (RELA)
   04658 Th1 and Th2 cell differentiation
    5970 (RELA)
   04659 Th17 cell differentiation
    5970 (RELA)
   04657 IL-17 signaling pathway
    5970 (RELA)
   04662 B cell receptor signaling pathway
    5970 (RELA)
   04062 Chemokine signaling pathway
    5970 (RELA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    5970 (RELA)
   04917 Prolactin signaling pathway
    5970 (RELA)
   04926 Relaxin signaling pathway
    5970 (RELA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    5970 (RELA)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    5970 (RELA)
  09149 Aging
   04211 Longevity regulating pathway
    5970 (RELA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5970 (RELA)
   05202 Transcriptional misregulation in cancer
    5970 (RELA)
   05203 Viral carcinogenesis
    5970 (RELA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    5970 (RELA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    5970 (RELA)
   05221 Acute myeloid leukemia
    5970 (RELA)
   05220 Chronic myeloid leukemia
    5970 (RELA)
   05215 Prostate cancer
    5970 (RELA)
   05222 Small cell lung cancer
    5970 (RELA)
  09163 Immune disease
   05321 Inflammatory bowel disease
    5970 (RELA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    5970 (RELA)
   05022 Pathways of neurodegeneration - multiple diseases
    5970 (RELA)
  09165 Substance dependence
   05030 Cocaine addiction
    5970 (RELA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5970 (RELA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    5970 (RELA)
   04931 Insulin resistance
    5970 (RELA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    5970 (RELA)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    5970 (RELA)
   05130 Pathogenic Escherichia coli infection
    5970 (RELA)
   05132 Salmonella infection
    5970 (RELA)
   05131 Shigellosis
    5970 (RELA)
   05135 Yersinia infection
    5970 (RELA)
   05133 Pertussis
    5970 (RELA)
   05134 Legionellosis
    5970 (RELA)
   05152 Tuberculosis
    5970 (RELA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    5970 (RELA)
   05170 Human immunodeficiency virus 1 infection
    5970 (RELA)
   05162 Measles
    5970 (RELA)
   05164 Influenza A
    5970 (RELA)
   05161 Hepatitis B
    5970 (RELA)
   05160 Hepatitis C
    5970 (RELA)
   05168 Herpes simplex virus 1 infection
    5970 (RELA)
   05163 Human cytomegalovirus infection
    5970 (RELA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    5970 (RELA)
   05169 Epstein-Barr virus infection
    5970 (RELA)
   05165 Human papillomavirus infection
    5970 (RELA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5970 (RELA)
   05145 Toxoplasmosis
    5970 (RELA)
   05140 Leishmaniasis
    5970 (RELA)
   05142 Chagas disease
    5970 (RELA)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    5970 (RELA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5970 (RELA)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    5970 (RELA)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 5970
NCBI-ProteinID: NP_068810
OMIM: 164014
HGNC: 9955
Ensembl: ENSG00000173039
Vega: OTTHUMG00000166566
Pharos: Q04206(Tchem)
UniProt: Q04206
LinkDB
Structure
PDB: 
1NFI 2O61 3GUT

Position
11q13.1
AA seq 551 aa
MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPT
IKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQC
VKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLS
HPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFS
QADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEE
KRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYPFTSSLSTINY
DEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA
VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQ
GIPVAPHTTEPMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADM
DFSALLSQISS
NT seq 1656 nt   +upstreamnt  +downstreamnt
atggacgaactgttccccctcatcttcccggcagagccagcccaggcctctggcccctat
gtggagatcattgagcagcccaagcagcggggcatgcgcttccgctacaagtgcgagggg
cgctccgcgggcagcatcccaggcgagaggagcacagataccaccaagacccaccccacc
atcaagatcaatggctacacaggaccagggacagtgcgcatctccctggtcaccaaggac
cctcctcaccggcctcacccccacgagcttgtaggaaaggactgccgggatggcttctat
gaggctgagctctgcccggaccgctgcatccacagtttccagaacctgggaatccagtgt
gtgaagaagcgggacctggagcaggctatcagtcagcgcatccagaccaacaacaacccc
ttccaagttcctatagaagagcagcgtggggactacgacctgaatgctgtgcggctctgc
ttccaggtgacagtgcgggacccatcaggcaggcccctccgcctgccgcctgtcctttct
catcccatctttgacaatcgtgcccccaacactgccgagctcaagatctgccgagtgaac
cgaaactctggcagctgcctcggtggggatgagatcttcctactgtgtgacaaggtgcag
aaagaggacattgaggtgtatttcacgggaccaggctgggaggcccgaggctccttttcg
caagctgatgtgcaccgacaagtggccattgtgttccggacccctccctacgcagacccc
agcctgcaggctcctgtgcgtgtctccatgcagctgcggcggccttccgaccgggagctc
agtgagcccatggaattccagtacctgccagatacagacgatcgtcaccggattgaggag
aaacgtaaaaggacatatgagaccttcaagagcatcatgaagaagagtcctttcagcgga
cccaccgacccccggcctccacctcgacgcattgctgtgccttcccgcagctcagcttct
gtccccaagccagcaccccagccctatccctttacgtcatccctgagcaccatcaactat
gatgagtttcccaccatggtgtttccttctgggcagatcagccaggcctcggccttggcc
ccggcccctccccaagtcctgccccaggctccagcccctgcccctgctccagccatggta
tcagctctggcccaggccccagcccctgtcccagtcctagccccaggccctcctcaggct
gtggccccacctgcccccaagcccacccaggctggggaaggaacgctgtcagaggccctg
ctgcagctgcagtttgatgatgaagacctgggggccttgcttggcaacagcacagaccca
gctgtgttcacagacctggcatccgtcgacaactccgagtttcagcagctgctgaaccag
ggcatacctgtggccccccacacaactgagcccatgctgatggagtaccctgaggctata
actcgcctagtgacaggggcccagaggccccccgacccagctcctgctccactgggggcc
ccggggctccccaatggcctcctttcaggagatgaagacttctcctccattgcggacatg
gacttctcagccctgctgagtcagatcagctcctaa

KEGG   Homo sapiens (human): 6347
Entry
6347              CDS       T01001                                 

Gene name
CCL2, GDCF-2, HC11, HSMCR30, MCAF, MCP-1, MCP1, SCYA2, SMC-CF
Definition
(RefSeq) C-C motif chemokine ligand 2
  KO
K14624  C-C motif chemokine 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04657  IL-17 signaling pathway
hsa04668  TNF signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05144  Malaria
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06123  TNF signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06224  CXCR signaling
  Element
N00153  CCR/CXCR-GNB/G-PI3K-RAC signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
N00560  HSV gD to HVEM-NFKB signaling pathway
N01173  CCL2/7/8/13/27 to CCR2 signaling
N01174  VAV vCCI to CCR signaling
N01175  CCL2 to HCMV US28 signaling
N01176  CCL2 to HHV6 U12 signaling
N01177  CCL2 to HHV6 U51 signaling
Drug target
Bindarit: D03116
Carlumab: D09877
Pirfenidone: D01583<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    6347 (CCL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    6347 (CCL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    6347 (CCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    6347 (CCL2)
   04657 IL-17 signaling pathway
    6347 (CCL2)
   04062 Chemokine signaling pathway
    6347 (CCL2)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    6347 (CCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6347 (CCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    6347 (CCL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    6347 (CCL2)
  09172 Infectious disease: viral
   05164 Influenza A
    6347 (CCL2)
   05168 Herpes simplex virus 1 infection
    6347 (CCL2)
   05163 Human cytomegalovirus infection
    6347 (CCL2)
  09174 Infectious disease: parasitic
   05144 Malaria
    6347 (CCL2)
   05142 Chagas disease
    6347 (CCL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    6347 (CCL2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6347 (CCL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Chemokines
   6347 (CCL2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Chemokines
   6347 (CCL2)
SSDB
Motif
Pfam: IL8
Other DBs
NCBI-GeneID: 6347
NCBI-ProteinID: NP_002973
OMIM: 158105
HGNC: 10618
Ensembl: ENSG00000108691
Vega: OTTHUMG00000132887
Pharos: P13500(Tchem)
UniProt: P13500
LinkDB
Structure
PDB: 

Position
17q12
AA seq 99 aa
MKVSAALLCLLLIAATFIPQGLAQPDAINAPVTCCYNFTNRKISVQRLASYRRITSSKCP
KEAVIFKTIVAKEICADPKQKWVQDSMDHLDKQTQTPKT
NT seq 300 nt   +upstreamnt  +downstreamnt
atgaaagtctctgccgcccttctgtgcctgctgctcatagcagccaccttcattccccaa
gggctcgctcagccagatgcaatcaatgccccagtcacctgctgttataacttcaccaat
aggaagatctcagtgcagaggctcgcgagctatagaagaatcaccagcagcaagtgtccc
aaagaagctgtgatcttcaagaccattgtggccaaggagatctgtgctgaccccaagcag
aagtgggttcaggattccatggaccacctggacaagcaaacccaaactccgaagacttga

DBGET integrated database retrieval system