KEGG   Homo sapiens (human): 3309
Entry
3309              CDS       T01001                                 

Gene name
HSPA5, BIP, GRP78, HEL-S-89n
Definition
(RefSeq) heat shock protein family A (Hsp70) member 5
  KO
K09490  endoplasmic reticulum chaperone BiP [EC:3.6.4.10]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03060  Protein export
hsa04141  Protein processing in endoplasmic reticulum
hsa04612  Antigen processing and presentation
hsa04918  Thyroid hormone synthesis
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06412  Unfolded protein response (UPR) signaling
nt06460  Alzheimer disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
nt06465  Prion disease
  Element
N01015  ATF6-mediated transcription
N01033  Mutation-caused aberrant SNCA to ATF6-mediated transcription
N01034  Mutation-caused aberrant SNCA to IRE1a-XBP1 signaling pathway
N01035  Mutation-caused aberrant SNCA to PERK-ATF4 signaling pathway
N01147  Mutation-caused aberrant SOD1 to ATF6-mediated transcription
N01148  Mutation-caused aberrant SOD1 to IRE1a-XBP1 signaling pathway
N01149  Mutation-caused aberrant SOD1 to PERK-ATF4 signaling pathway
N01198  Scrapie conformation PrPSc to PERK-ATF4 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    3309 (HSPA5)
   04141 Protein processing in endoplasmic reticulum
    3309 (HSPA5)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    3309 (HSPA5)
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    3309 (HSPA5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    3309 (HSPA5)
   05014 Amyotrophic lateral sclerosis
    3309 (HSPA5)
   05020 Prion disease
    3309 (HSPA5)
   05022 Pathways of neurodegeneration - multiple diseases
    3309 (HSPA5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    3309 (HSPA5)
   04131 Membrane trafficking [BR:hsa04131]
    3309 (HSPA5)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3309 (HSPA5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.10  non-chaperonin molecular chaperone ATPase
     3309 (HSPA5)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP70 / DNAK
   3309 (HSPA5)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    3309 (HSPA5)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3309 (HSPA5)
  Exosomal proteins of other body fluids (saliva and urine)
   3309 (HSPA5)
  Exosomal proteins of colorectal cancer cells
   3309 (HSPA5)
SSDB
Motif
Pfam: HSP70 MreB_Mbl FtsA Hydantoinase_A DDR FGGY_C DUF4795
Other DBs
NCBI-GeneID: 3309
NCBI-ProteinID: NP_005338
OMIM: 138120
HGNC: 5238
Ensembl: ENSG00000044574
Vega: OTTHUMG00000020672
Pharos: P11021(Tchem)
UniProt: P11021 V9HWB4
LinkDB
Structure
PDB: 

Position
9q33.3
AA seq 654 aa
MKLSLVAAMLLLLSAARAEEEDKKEDVGTVVGIDLGTTYSCVGVFKNGRVEIIANDQGNR
ITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVV
EKKTKPYIQVDIGGGQTKTFAPEEISAMVLTKMKETAEAYLGKKVTHAVVTVPAYFNDAQ
RQATKDAGTIAGLNVMRIINEPTAAAIAYGLDKREGEKNILVFDLGGGTFDVSLLTIDNG
VFEVVATNGDTHLGGEDFDQRVMEHFIKLYKKKTGKDVRKDNRAVQKLRREVEKAKRALS
SQHQARIEIESFYEGEDFSETLTRAKFEELNMDLFRSTMKPVQKVLEDSDLKKSDIDEIV
LVGGSTRIPKIQQLVKEFFNGKEPSRGINPDEAVAYGAAVQAGVLSGDQDTGDLVLLDVC
PLTLGIETVGGVMTKLIPRNTVVPTKKSQIFSTASDNQPTVTIKVYEGERPLTKDNHLLG
TFDLTGIPPAPRGVPQIEVTFEIDVNGILRVTAEDKGTGNKNKITITNDQNRLTPEEIER
MVNDAEKFAEEDKKLKERIDTRNELESYAYSLKNQIGDKEKLGGKLSSEDKETMEKAVEE
KIEWLESHQDADIEDFKAKKKELEEIVQPIISKLYGSAGPPPTGEEDTAEKDEL
NT seq 1965 nt   +upstreamnt  +downstreamnt
atgaagctctccctggtggccgcgatgctgctgctgctcagcgcggcgcgggccgaggag
gaggacaagaaggaggacgtgggcacggtggtcggcatcgacctggggaccacctactcc
tgcgtcggcgtgttcaagaacggccgcgtggagatcatcgccaacgatcagggcaaccgc
atcacgccgtcctatgtcgccttcactcctgaaggggaacgtctgattggcgatgccgcc
aagaaccagctcacctccaaccccgagaacacggtctttgacgccaagcggctcatcggc
cgcacgtggaatgacccgtctgtgcagcaggacatcaagttcttgccgttcaaggtggtt
gaaaagaaaactaaaccatacattcaagttgatattggaggtgggcaaacaaagacattt
gctcctgaagaaatttctgccatggttctcactaaaatgaaagaaaccgctgaggcttat
ttgggaaagaaggttacccatgcagttgttactgtaccagcctattttaatgatgcccaa
cgccaagcaaccaaagacgctggaactattgctggcctaaatgttatgaggatcatcaac
gagcctacggcagctgctattgcttatggcctggataagagggagggggagaagaacatc
ctggtgtttgacctgggtggcggaaccttcgatgtgtctcttctcaccattgacaatggt
gtcttcgaagttgtggccactaatggagatactcatctgggtggagaagactttgaccag
cgtgtcatggaacacttcatcaaactgtacaaaaagaagacgggcaaagatgtcaggaaa
gacaatagagctgtgcagaaactccggcgcgaggtagaaaaggccaaacgggccctgtct
tctcagcatcaagcaagaattgaaattgagtccttctatgaaggagaagacttttctgag
accctgactcgggccaaatttgaagagctcaacatggatctgttccggtctactatgaag
cccgtccagaaagtgttggaagattctgatttgaagaagtctgatattgatgaaattgtt
cttgttggtggctcgactcgaattccaaagattcagcaactggttaaagagttcttcaat
ggcaaggaaccatcccgtggcataaacccagatgaagctgtagcgtatggtgctgctgtc
caggctggtgtgctctctggtgatcaagatacaggtgacctggtactgcttgatgtatgt
ccccttacacttggtattgaaactgtgggaggtgtcatgaccaaactgattccaaggaac
acagtggtgcctaccaagaagtctcagatcttttctacagcttctgataatcaaccaact
gttacaatcaaggtctatgaaggtgaaagacccctgacaaaagacaatcatcttctgggt
acatttgatctgactggaattcctcctgctcctcgtggggtcccacagattgaagtcacc
tttgagatagatgtgaatggtattcttcgagtgacagctgaagacaagggtacagggaac
aaaaataagatcacaatcaccaatgaccagaatcgcctgacacctgaagaaatcgaaagg
atggttaatgatgctgagaagtttgctgaggaagacaaaaagctcaaggagcgcattgat
actagaaatgagttggaaagctatgcctattctctaaagaatcagattggagataaagaa
aagctgggaggtaaactttcctctgaagataaggagaccatggaaaaagctgtagaagaa
aagattgaatggctggaaagccaccaagatgctgacattgaagacttcaaagctaagaag
aaggaactggaagaaattgttcaaccaattatcagcaaactctatggaagtgcaggccct
cccccaactggtgaagaggatacagcagaaaaagatgagttgtag

DBGET integrated database retrieval system