KEGG   Homo sapiens (human): 332
Entry
332               CDS       T01001                                 

Gene name
BIRC5, API4, EPR-1
Definition
(RefSeq) baculoviral IAP repeat containing 5
  KO
K08731  baculoviral IAP repeat-containing protein 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa04390  Hippo signaling pathway
hsa05161  Hepatitis B
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
Network
nt06131  Apoptosis (viruses and bacteria)
nt06162  Hepatitis B virus (HBV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06271  Endometrial cancer
  Element
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00533  HBV HBx to Crosstalk between extrinsic and intrinsic apoptotic pathways
Drug target
Gataparsen (DG01431): D09909 D09910
Sepantronium bromide: D10164
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    332 (BIRC5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    332 (BIRC5)
   04215 Apoptosis - multiple species
    332 (BIRC5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    332 (BIRC5)
  09162 Cancer: specific types
   05210 Colorectal cancer
    332 (BIRC5)
  09172 Infectious disease: viral
   05161 Hepatitis B
    332 (BIRC5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    332 (BIRC5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    332 (BIRC5)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    332 (BIRC5)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I32: IAP family
   332 (BIRC5)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CPC (chromosomal passenger complex)
     332 (BIRC5)
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    332 (BIRC5)
SSDB
Motif
Pfam: BIR
Other DBs
NCBI-GeneID: 332
NCBI-ProteinID: NP_001159
OMIM: 603352
HGNC: 593
Ensembl: ENSG00000089685
Vega: OTTHUMG00000177505
Pharos: O15392(Tchem)
UniProt: O15392 A0A0B4J1S3
LinkDB
Structure
PDB: 

Position
17q25.3
AA seq 142 aa
MGAPTLPPAWQPFLKDHRISTFKNWPFLEGCACTPERMAEAGFIHCPTENEPDLAQCFFC
FKELEGWEPDDDPIEEHKKHSSGCAFLSVKKQFEELTLGEFLKLDRERAKNKIAKETNNK
KKEFEETAEKVRRAIEQLAAMD
NT seq 429 nt   +upstreamnt  +downstreamnt
atgggtgccccgacgttgccccctgcctggcagccctttctcaaggaccaccgcatctct
acattcaagaactggcccttcttggagggctgcgcctgcaccccggagcggatggccgag
gctggcttcatccactgccccactgagaacgagccagacttggcccagtgtttcttctgc
ttcaaggagctggaaggctgggagccagatgacgaccccatagaggaacataaaaagcat
tcgtccggttgcgctttcctttctgtcaagaagcagtttgaagaattaacccttggtgaa
tttttgaaactggacagagaaagagccaagaacaaaattgcaaaggaaaccaacaataag
aagaaagaatttgaggaaactgcggagaaagtgcgccgtgccatcgagcagctggctgcc
atggattga

DBGET integrated database retrieval system