KEGG   Homo sapiens (human): 3350
Entry
3350              CDS       T01001                                 

Gene name
HTR1A, 5-HT-1A, 5-HT1A, 5HT1a, ADRB2RL1, ADRBRL1, G-21, PFMCD
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Adatanserin hydrochloride: D02767
Aripiprazole (DG00906): D01164<JP/US> D10355 D10364<US> D10516<JP/US>
Asenapine (DG03100): D02995<JP/US>
Bifeprunox (DG01304): D06566 D06567
Binospirone mesylate: D03121
Brexpiprazole: D10309<JP/US>
Buspirone (DG00913): D00702<US> D07593
Cariprazine (DG01305): D09876<US> D09997
Cinitapride (DG01520): D07700 D07701
Eptapirone: D02576
Ergot alkaloids: D07906
Ergotamine (DG00834): D00679<US>
Flesinoxan: D02568
Flibanserin: D02577<US>
Gepirone: D04314
Indorenate hydrochloride: D04533
Ipsapirone hydrochloride: D04611
Lecozotan hydrochloride: D04683
Methysergide (DG00835): D00681 D02357
Naluzotan (DG01279): D09358 D09359
Pardoprunox (DG01324): D09366 D09397
Pipotiazine (DG00884): D02680 D08385
Pizotifen (DG00842): D05523 D08397
Ralmitaront: D11830
Sarizotan hydrochloride: D05804
Sunepitron hydrochloride: D02569
Tandospirone (DG01306): D01992<JP> D08561
Tiospirone hydrochloride: D02688
Vilazodone (DG00964): D09698 D09699<US>
Vortioxetine (DG00965): D10184 D10185<JP/US>
Xaliproden (DG01008): D01537 D06327
Zalospirone hydrochloride: D06354
Zotepine: D01321<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3350 (HTR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3350 (HTR1A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3350 (HTR1A)
  09157 Sensory system
   04742 Taste transduction
    3350 (HTR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3350 (HTR1A)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3350 (HTR1A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 3350
NCBI-ProteinID: NP_000515
OMIM: 109760
HGNC: 5286
Ensembl: ENSG00000178394
Vega: OTTHUMG00000162279
Pharos: P08908(Tclin)
UniProt: P08908 Q5ZGX3 A8K5W4
LinkDB
Position
5q12.3
AA seq 422 aa
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggatgtgctcagccctggtcagggcaacaacaccacatcaccaccggctccctttgag
accggcggcaacactactggtatctccgacgtgaccgtcagctaccaagtgatcacctct
ctgctgctgggcacgctcatcttctgcgcggtgctgggcaatgcgtgcgtggtggctgcc
atcgccttggagcgctccctgcagaacgtggccaattatcttattggctctttggcggtc
accgacctcatggtgtcggtgttggtgctgcccatggccgcgctgtatcaggtgctcaac
aagtggacactgggccaggtaacctgcgacctgttcatcgccctcgacgtgctgtgctgc
acctcatccatcttgcacctgtgcgccatcgcgctggacaggtactgggccatcacggac
cccatcgactacgtgaacaagaggacgccccggcgcgccgctgcgctcatctcgctcact
tggcttattggcttcctcatctctatcccgcccatgctgggctggcgcaccccggaagac
cgctcggaccccgacgcatgcaccattagcaaggatcatggctacactatctattccacc
tttggagctttctacatcccgctgctgctcatgctggttctctatgggcgcatattccga
gctgcgcgcttccgcatccgcaagacggtcaaaaaggtggagaagaccggagcggacacc
cgccatggagcatctcccgccccgcagcccaagaagagtgtgaatggagagtcggggagc
aggaactggaggctgggcgtggagagcaaggctgggggtgctctgtgcgccaatggcgcg
gtgaggcaaggtgacgatggcgccgccctggaggtgatcgaggtgcaccgagtgggcaac
tccaaagagcacttgcctctgcccagcgaggctggtcctaccccttgtgcccccgcctct
ttcgagaggaaaaatgagcgcaacgccgaggcgaagcgcaagatggccctggcccgagag
aggaagacagtgaagacgctgggcatcatcatgggcaccttcatcctctgctggctgccc
ttcttcatcgtggctcttgttctgcccttctgcgagagcagctgccacatgcccaccctg
ttgggcgccataatcaattggctgggctactccaactctctgcttaaccccgtcatttac
gcatacttcaacaaggactttcaaaacgcgtttaagaagatcattaagtgtaagttctgc
cgccagtga

KEGG   Homo sapiens (human): 3351
Entry
3351              CDS       T01001                                 

Gene name
HTR1B, 5-HT-1B, 5-HT-1D-beta, 5-HT1B, 5-HT1DB, HTR1D2, HTR1DB, S12
Definition
(RefSeq) 5-hydroxytryptamine receptor 1B
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Almotriptan (DG00839): D02824 D02825<US>
Alniditan dihydrochloride: D02826
Avitriptan fumarate: D03014
Cinitapride (DG01520): D07700 D07701
Dihydroergotamine (DG00833): D02211<US> D07837 D07838
Eletriptan (DG00840): D01973<JP/US> D07887 D11617
Elzasonan (DG01314): D03982 D03983
Ergot alkaloids: D07906
Ergotamine (DG00834): D00679<US>
Frovatriptan (DG00841): D04264<US> D07997
Indorenate hydrochloride: D04533
Naratriptan (DG00837): D00674<JP/US> D08255
Pizotifen (DG00842): D05523 D08397
Rizatriptan (DG00838): D00675<JP/US> D05740 D08485
Sumatriptan (DG00836): D00451<JP/US> D00676<JP/US>
Zolmitriptan: D00415<JP/US>
Zotepine: D01321<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3351 (HTR1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3351 (HTR1B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3351 (HTR1B)
  09157 Sensory system
   04742 Taste transduction
    3351 (HTR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3351 (HTR1B)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3351 (HTR1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 3351
NCBI-ProteinID: NP_000854
OMIM: 182131
HGNC: 5287
Ensembl: ENSG00000135312
Vega: OTTHUMG00000015066
Pharos: P28222(Tclin)
UniProt: P28222 X5D7I5 A8K215
LinkDB
Structure
PDB: 
6G79

Position
6q14.1
AA seq 390 aa
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggaggaaccgggtgctcagtgcgctccaccgccgcccgcgggctccgagacctgggtt
cctcaagccaacttatcctctgctccctcccaaaactgcagcgccaaggactacatttac
caggactccatctccctaccctggaaagtactgctggttatgctattggcgctcatcacc
ttggccaccacgctctccaatgcctttgtgattgccacagtgtaccggacccggaaactg
cacaccccggctaactacctgatcgcctctctggcggtcaccgacctgcttgtgtccatc
ctggtgatgcccatcagcaccatgtacactgtcaccggccgctggacactgggccaggtg
gtctgtgacttctggctgtcgtcggacatcacttgttgcactgcctccatcctgcacctc
tgtgtcatcgccctggaccgctactgggccatcacggacgccgtggagtactcagctaaa
aggactcccaagagggcggcggtcatgatcgcgctggtgtgggtcttctccatctctatc
tcgctgccgcccttcttctggcgtcaggctaaggccgaagaggaggtgtcggaatgcgtg
gtgaacaccgaccacatcctctacacggtctactccacggtgggtgctttctacttcccc
accctgctcctcatcgccctctatggccgcatctacgtagaagcccgctcccggattttg
aaacagacgcccaacaggaccggcaagcgcttgacccgagcccagctgataaccgactcc
cccgggtccacgtcctcggtcacctctattaactcgcgggttcccgacgtgcccagcgaa
tccggatctcctgtgtatgtgaaccaagtcaaagtgcgagtctccgacgccctgctggaa
aagaagaaactcatggccgctagggagcgcaaagccaccaagaccctagggatcattttg
ggagcctttattgtgtgttggctacccttcttcatcatctccctagtgatgcctatctgc
aaagatgcctgctggttccacctagccatctttgacttcttcacatggctgggctatctc
aactccctcatcaaccccataatctataccatgtccaatgaggactttaaacaagcattc
cataaactgatacgttttaagtgcacaagttga

KEGG   Homo sapiens (human): 3352
Entry
3352              CDS       T01001                                 

Gene name
HTR1D, 5-HT1D, HT1DA, HTR1DA, HTRL, RDC4
Definition
(RefSeq) 5-hydroxytryptamine receptor 1D
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Disease
H01703  Eating Disorders
Drug target
Almotriptan (DG00839): D02824 D02825<US>
Alniditan dihydrochloride: D02826
Avitriptan fumarate: D03014
Cinitapride (DG01520): D07700 D07701
Dihydroergotamine (DG00833): D02211<US> D07837 D07838
Eletriptan (DG00840): D01973<JP/US> D07887 D11617
Elzasonan (DG01314): D03982 D03983
Ergot alkaloids: D07906
Ergotamine (DG00834): D00679<US>
Frovatriptan (DG00841): D04264<US> D07997
Indorenate hydrochloride: D04533
Naratriptan (DG00837): D00674<JP/US> D08255
Pizotifen (DG00842): D05523 D08397
Rizatriptan (DG00838): D00675<JP/US> D05740 D08485
Sumatriptan (DG00836): D00451<JP/US> D00676<JP/US>
Zolmitriptan: D00415<JP/US>
Zotepine: D01321<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3352 (HTR1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3352 (HTR1D)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3352 (HTR1D)
  09157 Sensory system
   04742 Taste transduction
    3352 (HTR1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3352 (HTR1D)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3352 (HTR1D)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 3352
NCBI-ProteinID: NP_000855
OMIM: 182133
HGNC: 5289
Ensembl: ENSG00000179546
Vega: OTTHUMG00000003235
Pharos: P28221(Tclin)
UniProt: P28221
LinkDB
Position
1p36.12
AA seq 377 aa
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtccccactgaaccagtcagcagaaggccttccccaggaggcctccaacagatccctg
aatgccacagaaacctcagaggcttgggatcccaggaccctccaggcgctcaagatctcc
cttgccgtggtcctttccgtcatcacactggccacagtcctctccaatgcctttgtactc
accaccatcttactcaccaggaagctccacacccctgccaactacctgattggctccctg
gccaccaccgacctcttggtttccatcttggtaatgcccatcagcatcgcctataccatc
acccacacctggaactttggccaaatcttgtgtgacatctggctgtcctctgacatcacg
tgctgcacagcctccatcctgcatctctgtgtcattgctctggacaggtactgggcaatc
acagatgccctggaatacagtaaacgcaggacggctggccacgcggccaccatgatcgcc
attgtctgggccatctccatctgcatctccatccccccgctcttctggcggcaggccaag
gcccaggaggagatgtcggactgtctggtgaacacctctcagatctcctacaccatctac
tccacctgtggggccttctacattccctcggtgttgctcatcatcctatatggccggatc
taccgggctgcccggaaccgcatcctgaatccaccctcactctatgggaagcgcttcacc
acggcccacctcatcacaggctctgccgggtcctcgctctgctcgctcaactccagcctc
catgaggggcactcgcactcggctggctcccctctctttttcaaccacgtgaaaatcaag
cttgctgacagtgccctggaacgcaagaggatttctgctgctcgagaaaggaaagccact
aaaatcctgggcatcattctgggggcctttatcatctgctggctgcccttcttcgtggtg
tctctggtcctccccatctgccgggactcctgctggatccacccggcgctctttgacttc
ttcacctggctaggctatttaaactccctcatcaatccaataatctacactgtgtttaat
gaagagtttcggcaagcttttcagaaaattgtccctttccggaaggcctcctag

KEGG   Homo sapiens (human): 3354
Entry
3354              CDS       T01001                                 

Gene name
HTR1E, 5-HT1E
Definition
(RefSeq) 5-hydroxytryptamine receptor 1E
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Cinitapride (DG01520): D07700 D07701
Indorenate hydrochloride: D04533
Pizotifen (DG00842): D05523 D08397
Zotepine: D01321<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3354 (HTR1E)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3354 (HTR1E)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3354 (HTR1E)
  09157 Sensory system
   04742 Taste transduction
    3354 (HTR1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3354 (HTR1E)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3354 (HTR1E)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 3354
NCBI-ProteinID: NP_000856
OMIM: 182132
HGNC: 5291
Ensembl: ENSG00000168830
Vega: OTTHUMG00000015154
Pharos: P28566(Tchem)
UniProt: P28566
LinkDB
Position
6q14.3
AA seq 365 aa
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaacatcacaaactgtaccacagaggccagcatggctataagacccaagaccatcact
gagaagatgctcatttgcatgactctggtggtcatcaccaccctcaccacgttgctgaac
ttggctgtgatcatggctattggcaccaccaagaagctccaccagcctgccaactaccta
atctgttctctggccgtgacggacctcctggtggcagtgctcgtcatgcccctgagcatc
atctacattgtcatggatcgctggaagcttgggtacttcctctgtgaggtgtggctgagt
gtggacatgacctgctgcacctgctccatcctccacctctgtgtcattgccctggacagg
tactgggccatcaccaatgctattgaatacgccaggaagaggacggccaagagggccgcg
ctgatgatccttaccgtctggaccatctccattttcatctccatgccccctctgttctgg
agaagccaccgccgcctaagccctccccctagtcagtgcaccatccagcacgaccatgtt
atctacaccatttactccacgctgggtgcgttttatatccccttgactttgatactgatt
ctctattaccggatttaccacgcggccaagagcctttaccagaaaaggggatcaagtcgg
cacttaagcaacagaagcacagatagccagaattcttttgcaagttgtaaacttacacag
actttctgtgtgtctgacttctccacctcagaccctaccacagagtttgaaaagttccat
gcctccatcaggatcccccccttcgacaatgatctagatcacccaggagaacgtcagcag
atctctagcaccagggaacggaaggcagcacgcatcctggggctgattctgggtgcattc
attttatcctggctgccatttttcatcaaagagttgattgtgggtctgagcatctacacc
gtgtcctcggaagtggccgactttctgacgtggctcggttatgtgaattctctgatcaac
cctctgctctatacgagttttaatgaagactttaagctggcttttaaaaagctcattaga
tgccgagagcatacttag

KEGG   Homo sapiens (human): 3355
Entry
3355              CDS       T01001                                 

Gene name
HTR1F, 5-HT-1F, 5-HT1F, 5HT6, HTR1EL, MR77
Definition
(RefSeq) 5-hydroxytryptamine receptor 1F
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Cinitapride (DG01520): D07700 D07701
Indorenate hydrochloride: D04533
Lasmiditan (DG01332): D10338 D10424<US>
Pizotifen (DG00842): D05523 D08397
Zotepine: D01321<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3355 (HTR1F)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3355 (HTR1F)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3355 (HTR1F)
  09157 Sensory system
   04742 Taste transduction
    3355 (HTR1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3355 (HTR1F)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3355 (HTR1F)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4 Glycoprotein_G
Other DBs
NCBI-GeneID: 3355
NCBI-ProteinID: NP_000857
OMIM: 182134
HGNC: 5292
Ensembl: ENSG00000179097
Vega: OTTHUMG00000159008
Pharos: P30939(Tchem)
UniProt: P30939
LinkDB
Position
3p11.2-p11.1
AA seq 366 aa
MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIV
STIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKS
VSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRC
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggatttcttaaattcatctgatcaaaacttgacctcagaggaactgttaaacagaatg
ccatccaaaattctggtgtccctcactctgtctgggctggcactgatgacaacaactatc
aactcccttgtgatcgctgcaattattgtgacccggaagctgcaccatccagccaattat
ttaatttgttcccttgcagtcacagattttcttgtggctgtcctggtgatgcccttcagc
attgtgtatattgtgagagagagctggattatggggcaagtggtctgtgacatttggctg
agtgttgacattacctgctgcacgtgctccatcttgcatctctcagctatagctttggat
cggtatcgagcaatcacagatgctgttgagtatgccaggaaaaggactccaaagcatgct
ggcattatgattacaatagtttggattatatctgtttttatctctatgcctcctctattc
tggaggcaccaaggaactagcagagatgatgaatgcatcatcaagcacgaccacattgtt
tccaccatttactcaacatttggagctttctacatcccactggcattgattttgatcctt
tactacaaaatatatagagcagcaaagacattataccacaagagacaagcaagtaggatt
gcaaaggaggaggtgaatggccaagtccttttggagagtggtgagaaaagcactaaatca
gtttccacatcctatgtactagaaaagtctttatctgacccatcaacagactttgataaa
attcatagcacagtgagaagtctcaggtctgaattcaagcatgagaaatcttggagaagg
caaaagatctcaggtacaagagaacggaaagcagccactaccctgggattaatcttgggt
gcatttgtaatatgttggcttcctttttttgtaaaagaattagttgttaatgtctgtgac
aaatgtaaaatttctgaagaaatgtccaattttttggcatggcttgggtatctcaattcc
cttataaatccactgatttacacaatctttaatgaagacttcaagaaagcattccaaaag
cttgtgcgatgtcgatgttag

DBGET integrated database retrieval system