KEGG   Homo sapiens (human): 3350
Entry
3350              CDS       T01001                                 

Gene name
HTR1A, 5-HT-1A, 5-HT1A, 5HT1a, ADRB2RL1, ADRBRL1, G-21, PFMCD
Definition
(RefSeq) 5-hydroxytryptamine receptor 1A
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Adatanserin hydrochloride: D02767
Aripiprazole (DG00906): D01164<JP/US> D10355 D10364<US> D10516<JP/US>
Asenapine (DG03100): D02995<JP/US>
Bifeprunox (DG01304): D06566 D06567
Binospirone mesylate: D03121
Brexpiprazole: D10309<JP/US>
Buspirone (DG00913): D00702<US> D07593
Cariprazine (DG01305): D09876<US> D09997
Cinitapride (DG01520): D07700 D07701
Eptapirone: D02576
Ergot alkaloids: D07906
Ergotamine (DG00834): D00679<US>
Flesinoxan: D02568
Flibanserin: D02577<US>
Gepirone: D04314
Indorenate hydrochloride: D04533
Ipsapirone hydrochloride: D04611
Lecozotan hydrochloride: D04683
Methysergide (DG00835): D00681 D02357
Naluzotan (DG01279): D09358 D09359
Pardoprunox (DG01324): D09366 D09397
Pipotiazine (DG00884): D02680 D08385
Pizotifen (DG00842): D05523 D08397
Ralmitaront: D11830
Sarizotan hydrochloride: D05804
Sunepitron hydrochloride: D02569
Tandospirone (DG01306): D01992<JP> D08561
Tiospirone hydrochloride: D02688
Vilazodone (DG00964): D09698 D09699<US>
Vortioxetine (DG00965): D10184 D10185<JP/US>
Xaliproden (DG01008): D01537 D06327
Zalospirone hydrochloride: D06354
Zotepine: D01321<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3350 (HTR1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3350 (HTR1A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3350 (HTR1A)
  09157 Sensory system
   04742 Taste transduction
    3350 (HTR1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3350 (HTR1A)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3350 (HTR1A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 3350
NCBI-ProteinID: NP_000515
OMIM: 109760
HGNC: 5286
Ensembl: ENSG00000178394
Vega: OTTHUMG00000162279
Pharos: P08908(Tclin)
UniProt: P08908 Q5ZGX3 A8K5W4
LinkDB
Position
5q12.3
AA seq 422 aa
MDVLSPGQGNNTTSPPAPFETGGNTTGISDVTVSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVKKVEKTGADT
RHGASPAPQPKKSVNGESGSRNWRLGVESKAGGALCANGAVRQGDDGAALEVIEVHRVGN
SKEHLPLPSEAGPTPCAPASFERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPTLLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RQ
NT seq 1269 nt   +upstreamnt  +downstreamnt
atggatgtgctcagccctggtcagggcaacaacaccacatcaccaccggctccctttgag
accggcggcaacactactggtatctccgacgtgaccgtcagctaccaagtgatcacctct
ctgctgctgggcacgctcatcttctgcgcggtgctgggcaatgcgtgcgtggtggctgcc
atcgccttggagcgctccctgcagaacgtggccaattatcttattggctctttggcggtc
accgacctcatggtgtcggtgttggtgctgcccatggccgcgctgtatcaggtgctcaac
aagtggacactgggccaggtaacctgcgacctgttcatcgccctcgacgtgctgtgctgc
acctcatccatcttgcacctgtgcgccatcgcgctggacaggtactgggccatcacggac
cccatcgactacgtgaacaagaggacgccccggcgcgccgctgcgctcatctcgctcact
tggcttattggcttcctcatctctatcccgcccatgctgggctggcgcaccccggaagac
cgctcggaccccgacgcatgcaccattagcaaggatcatggctacactatctattccacc
tttggagctttctacatcccgctgctgctcatgctggttctctatgggcgcatattccga
gctgcgcgcttccgcatccgcaagacggtcaaaaaggtggagaagaccggagcggacacc
cgccatggagcatctcccgccccgcagcccaagaagagtgtgaatggagagtcggggagc
aggaactggaggctgggcgtggagagcaaggctgggggtgctctgtgcgccaatggcgcg
gtgaggcaaggtgacgatggcgccgccctggaggtgatcgaggtgcaccgagtgggcaac
tccaaagagcacttgcctctgcccagcgaggctggtcctaccccttgtgcccccgcctct
ttcgagaggaaaaatgagcgcaacgccgaggcgaagcgcaagatggccctggcccgagag
aggaagacagtgaagacgctgggcatcatcatgggcaccttcatcctctgctggctgccc
ttcttcatcgtggctcttgttctgcccttctgcgagagcagctgccacatgcccaccctg
ttgggcgccataatcaattggctgggctactccaactctctgcttaaccccgtcatttac
gcatacttcaacaaggactttcaaaacgcgtttaagaagatcattaagtgtaagttctgc
cgccagtga

KEGG   Homo sapiens (human): 3351
Entry
3351              CDS       T01001                                 

Gene name
HTR1B, 5-HT-1B, 5-HT-1D-beta, 5-HT1B, 5-HT1DB, HTR1D2, HTR1DB, S12
Definition
(RefSeq) 5-hydroxytryptamine receptor 1B
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Almotriptan (DG00839): D02824 D02825<US>
Alniditan dihydrochloride: D02826
Avitriptan fumarate: D03014
Cinitapride (DG01520): D07700 D07701
Dihydroergotamine (DG00833): D02211<US> D07837 D07838
Eletriptan (DG00840): D01973<JP/US> D07887 D11617
Elzasonan (DG01314): D03982 D03983
Ergot alkaloids: D07906
Ergotamine (DG00834): D00679<US>
Frovatriptan (DG00841): D04264<US> D07997
Indorenate hydrochloride: D04533
Naratriptan (DG00837): D00674<JP/US> D08255
Pizotifen (DG00842): D05523 D08397
Rizatriptan (DG00838): D00675<JP/US> D05740 D08485
Sumatriptan (DG00836): D00451<JP/US> D00676<JP/US>
Zolmitriptan: D00415<JP/US>
Zotepine: D01321<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3351 (HTR1B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3351 (HTR1B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3351 (HTR1B)
  09157 Sensory system
   04742 Taste transduction
    3351 (HTR1B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3351 (HTR1B)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3351 (HTR1B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 3351
NCBI-ProteinID: NP_000854
OMIM: 182131
HGNC: 5287
Ensembl: ENSG00000135312
Vega: OTTHUMG00000015066
Pharos: P28222(Tclin)
UniProt: P28222 X5D7I5 A8K215
LinkDB
Structure
PDB: 
6G79

Position
6q14.1
AA seq 390 aa
MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWKVLLVMLLALIT
LATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQV
VCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKRTPKRAAVMIALVWVFSISI
SLPPFFWRQAKAEEEVSECVVNTDHILYTVYSTVGAFYFPTLLLIALYGRIYVEARSRIL
KQTPNRTGKRLTRAQLITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLE
KKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWFHLAIFDFFTWLGYL
NSLINPIIYTMSNEDFKQAFHKLIRFKCTS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggaggaaccgggtgctcagtgcgctccaccgccgcccgcgggctccgagacctgggtt
cctcaagccaacttatcctctgctccctcccaaaactgcagcgccaaggactacatttac
caggactccatctccctaccctggaaagtactgctggttatgctattggcgctcatcacc
ttggccaccacgctctccaatgcctttgtgattgccacagtgtaccggacccggaaactg
cacaccccggctaactacctgatcgcctctctggcggtcaccgacctgcttgtgtccatc
ctggtgatgcccatcagcaccatgtacactgtcaccggccgctggacactgggccaggtg
gtctgtgacttctggctgtcgtcggacatcacttgttgcactgcctccatcctgcacctc
tgtgtcatcgccctggaccgctactgggccatcacggacgccgtggagtactcagctaaa
aggactcccaagagggcggcggtcatgatcgcgctggtgtgggtcttctccatctctatc
tcgctgccgcccttcttctggcgtcaggctaaggccgaagaggaggtgtcggaatgcgtg
gtgaacaccgaccacatcctctacacggtctactccacggtgggtgctttctacttcccc
accctgctcctcatcgccctctatggccgcatctacgtagaagcccgctcccggattttg
aaacagacgcccaacaggaccggcaagcgcttgacccgagcccagctgataaccgactcc
cccgggtccacgtcctcggtcacctctattaactcgcgggttcccgacgtgcccagcgaa
tccggatctcctgtgtatgtgaaccaagtcaaagtgcgagtctccgacgccctgctggaa
aagaagaaactcatggccgctagggagcgcaaagccaccaagaccctagggatcattttg
ggagcctttattgtgtgttggctacccttcttcatcatctccctagtgatgcctatctgc
aaagatgcctgctggttccacctagccatctttgacttcttcacatggctgggctatctc
aactccctcatcaaccccataatctataccatgtccaatgaggactttaaacaagcattc
cataaactgatacgttttaagtgcacaagttga

KEGG   Homo sapiens (human): 3352
Entry
3352              CDS       T01001                                 

Gene name
HTR1D, 5-HT1D, HT1DA, HTR1DA, HTRL, RDC4
Definition
(RefSeq) 5-hydroxytryptamine receptor 1D
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Disease
H01703  Eating Disorders
Drug target
Almotriptan (DG00839): D02824 D02825<US>
Alniditan dihydrochloride: D02826
Avitriptan fumarate: D03014
Cinitapride (DG01520): D07700 D07701
Dihydroergotamine (DG00833): D02211<US> D07837 D07838
Eletriptan (DG00840): D01973<JP/US> D07887 D11617
Elzasonan (DG01314): D03982 D03983
Ergot alkaloids: D07906
Ergotamine (DG00834): D00679<US>
Frovatriptan (DG00841): D04264<US> D07997
Indorenate hydrochloride: D04533
Naratriptan (DG00837): D00674<JP/US> D08255
Pizotifen (DG00842): D05523 D08397
Rizatriptan (DG00838): D00675<JP/US> D05740 D08485
Sumatriptan (DG00836): D00451<JP/US> D00676<JP/US>
Zolmitriptan: D00415<JP/US>
Zotepine: D01321<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3352 (HTR1D)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3352 (HTR1D)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3352 (HTR1D)
  09157 Sensory system
   04742 Taste transduction
    3352 (HTR1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3352 (HTR1D)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3352 (HTR1D)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 3352
NCBI-ProteinID: NP_000855
OMIM: 182133
HGNC: 5289
Ensembl: ENSG00000179546
Vega: OTTHUMG00000003235
Pharos: P28221(Tclin)
UniProt: P28221
LinkDB
Position
1p36.12
AA seq 377 aa
MSPLNQSAEGLPQEASNRSLNATETSEAWDPRTLQALKISLAVVLSVITLATVLSNAFVL
TTILLTRKLHTPANYLIGSLATTDLLVSILVMPISIAYTITHTWNFGQILCDIWLSSDIT
CCTASILHLCVIALDRYWAITDALEYSKRRTAGHAATMIAIVWAISICISIPPLFWRQAK
AQEEMSDCLVNTSQISYTIYSTCGAFYIPSVLLIILYGRIYRAARNRILNPPSLYGKRFT
TAHLITGSAGSSLCSLNSSLHEGHSHSAGSPLFFNHVKIKLADSALERKRISAARERKAT
KILGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPIIYTVFN
EEFRQAFQKIVPFRKAS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgtccccactgaaccagtcagcagaaggccttccccaggaggcctccaacagatccctg
aatgccacagaaacctcagaggcttgggatcccaggaccctccaggcgctcaagatctcc
cttgccgtggtcctttccgtcatcacactggccacagtcctctccaatgcctttgtactc
accaccatcttactcaccaggaagctccacacccctgccaactacctgattggctccctg
gccaccaccgacctcttggtttccatcttggtaatgcccatcagcatcgcctataccatc
acccacacctggaactttggccaaatcttgtgtgacatctggctgtcctctgacatcacg
tgctgcacagcctccatcctgcatctctgtgtcattgctctggacaggtactgggcaatc
acagatgccctggaatacagtaaacgcaggacggctggccacgcggccaccatgatcgcc
attgtctgggccatctccatctgcatctccatccccccgctcttctggcggcaggccaag
gcccaggaggagatgtcggactgtctggtgaacacctctcagatctcctacaccatctac
tccacctgtggggccttctacattccctcggtgttgctcatcatcctatatggccggatc
taccgggctgcccggaaccgcatcctgaatccaccctcactctatgggaagcgcttcacc
acggcccacctcatcacaggctctgccgggtcctcgctctgctcgctcaactccagcctc
catgaggggcactcgcactcggctggctcccctctctttttcaaccacgtgaaaatcaag
cttgctgacagtgccctggaacgcaagaggatttctgctgctcgagaaaggaaagccact
aaaatcctgggcatcattctgggggcctttatcatctgctggctgcccttcttcgtggtg
tctctggtcctccccatctgccgggactcctgctggatccacccggcgctctttgacttc
ttcacctggctaggctatttaaactccctcatcaatccaataatctacactgtgtttaat
gaagagtttcggcaagcttttcagaaaattgtccctttccggaaggcctcctag

KEGG   Homo sapiens (human): 3354
Entry
3354              CDS       T01001                                 

Gene name
HTR1E, 5-HT1E
Definition
(RefSeq) 5-hydroxytryptamine receptor 1E
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Cinitapride (DG01520): D07700 D07701
Indorenate hydrochloride: D04533
Pizotifen (DG00842): D05523 D08397
Zotepine: D01321<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3354 (HTR1E)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3354 (HTR1E)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3354 (HTR1E)
  09157 Sensory system
   04742 Taste transduction
    3354 (HTR1E)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3354 (HTR1E)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3354 (HTR1E)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 3354
NCBI-ProteinID: NP_000856
OMIM: 182132
HGNC: 5291
Ensembl: ENSG00000168830
Vega: OTTHUMG00000015154
Pharos: P28566(Tchem)
UniProt: P28566
LinkDB
Position
6q14.3
AA seq 365 aa
MNITNCTTEASMAIRPKTITEKMLICMTLVVITTLTTLLNLAVIMAIGTTKKLHQPANYL
ICSLAVTDLLVAVLVMPLSIIYIVMDRWKLGYFLCEVWLSVDMTCCTCSILHLCVIALDR
YWAITNAIEYARKRTAKRAALMILTVWTISIFISMPPLFWRSHRRLSPPPSQCTIQHDHV
IYTIYSTLGAFYIPLTLILILYYRIYHAAKSLYQKRGSSRHLSNRSTDSQNSFASCKLTQ
TFCVSDFSTSDPTTEFEKFHASIRIPPFDNDLDHPGERQQISSTRERKAARILGLILGAF
ILSWLPFFIKELIVGLSIYTVSSEVADFLTWLGYVNSLINPLLYTSFNEDFKLAFKKLIR
CREHT
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgaacatcacaaactgtaccacagaggccagcatggctataagacccaagaccatcact
gagaagatgctcatttgcatgactctggtggtcatcaccaccctcaccacgttgctgaac
ttggctgtgatcatggctattggcaccaccaagaagctccaccagcctgccaactaccta
atctgttctctggccgtgacggacctcctggtggcagtgctcgtcatgcccctgagcatc
atctacattgtcatggatcgctggaagcttgggtacttcctctgtgaggtgtggctgagt
gtggacatgacctgctgcacctgctccatcctccacctctgtgtcattgccctggacagg
tactgggccatcaccaatgctattgaatacgccaggaagaggacggccaagagggccgcg
ctgatgatccttaccgtctggaccatctccattttcatctccatgccccctctgttctgg
agaagccaccgccgcctaagccctccccctagtcagtgcaccatccagcacgaccatgtt
atctacaccatttactccacgctgggtgcgttttatatccccttgactttgatactgatt
ctctattaccggatttaccacgcggccaagagcctttaccagaaaaggggatcaagtcgg
cacttaagcaacagaagcacagatagccagaattcttttgcaagttgtaaacttacacag
actttctgtgtgtctgacttctccacctcagaccctaccacagagtttgaaaagttccat
gcctccatcaggatcccccccttcgacaatgatctagatcacccaggagaacgtcagcag
atctctagcaccagggaacggaaggcagcacgcatcctggggctgattctgggtgcattc
attttatcctggctgccatttttcatcaaagagttgattgtgggtctgagcatctacacc
gtgtcctcggaagtggccgactttctgacgtggctcggttatgtgaattctctgatcaac
cctctgctctatacgagttttaatgaagactttaagctggcttttaaaaagctcattaga
tgccgagagcatacttag

KEGG   Homo sapiens (human): 3355
Entry
3355              CDS       T01001                                 

Gene name
HTR1F, 5-HT-1F, 5-HT1F, 5HT6, HTR1EL, MR77
Definition
(RefSeq) 5-hydroxytryptamine receptor 1F
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
hsa04742  Taste transduction
Drug target
Cinitapride (DG01520): D07700 D07701
Indorenate hydrochloride: D04533
Lasmiditan (DG01332): D10338 D10424<US>
Pizotifen (DG00842): D05523 D08397
Zotepine: D01321<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    3355 (HTR1F)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3355 (HTR1F)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3355 (HTR1F)
  09157 Sensory system
   04742 Taste transduction
    3355 (HTR1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3355 (HTR1F)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3355 (HTR1F)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7TM_GPCR_Srx 7tm_4 Glycoprotein_G
Other DBs
NCBI-GeneID: 3355
NCBI-ProteinID: NP_000857
OMIM: 182134
HGNC: 5292
Ensembl: ENSG00000179097
Vega: OTTHUMG00000159008
Pharos: P30939(Tchem)
UniProt: P30939
LinkDB
Position
3p11.2-p11.1
AA seq 366 aa
MDFLNSSDQNLTSEELLNRMPSKILVSLTLSGLALMTTTINSLVIAAIIVTRKLHHPANY
LICSLAVTDFLVAVLVMPFSIVYIVRESWIMGQVVCDIWLSVDITCCTCSILHLSAIALD
RYRAITDAVEYARKRTPKHAGIMITIVWIISVFISMPPLFWRHQGTSRDDECIIKHDHIV
STIYSTFGAFYIPLALILILYYKIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKS
VSTSYVLEKSLSDPSTDFDKIHSTVRSLRSEFKHEKSWRRQKISGTRERKAATTLGLILG
AFVICWLPFFVKELVVNVCDKCKISEEMSNFLAWLGYLNSLINPLIYTIFNEDFKKAFQK
LVRCRC
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggatttcttaaattcatctgatcaaaacttgacctcagaggaactgttaaacagaatg
ccatccaaaattctggtgtccctcactctgtctgggctggcactgatgacaacaactatc
aactcccttgtgatcgctgcaattattgtgacccggaagctgcaccatccagccaattat
ttaatttgttcccttgcagtcacagattttcttgtggctgtcctggtgatgcccttcagc
attgtgtatattgtgagagagagctggattatggggcaagtggtctgtgacatttggctg
agtgttgacattacctgctgcacgtgctccatcttgcatctctcagctatagctttggat
cggtatcgagcaatcacagatgctgttgagtatgccaggaaaaggactccaaagcatgct
ggcattatgattacaatagtttggattatatctgtttttatctctatgcctcctctattc
tggaggcaccaaggaactagcagagatgatgaatgcatcatcaagcacgaccacattgtt
tccaccatttactcaacatttggagctttctacatcccactggcattgattttgatcctt
tactacaaaatatatagagcagcaaagacattataccacaagagacaagcaagtaggatt
gcaaaggaggaggtgaatggccaagtccttttggagagtggtgagaaaagcactaaatca
gtttccacatcctatgtactagaaaagtctttatctgacccatcaacagactttgataaa
attcatagcacagtgagaagtctcaggtctgaattcaagcatgagaaatcttggagaagg
caaaagatctcaggtacaagagaacggaaagcagccactaccctgggattaatcttgggt
gcatttgtaatatgttggcttcctttttttgtaaaagaattagttgttaatgtctgtgac
aaatgtaaaatttctgaagaaatgtccaattttttggcatggcttgggtatctcaattcc
cttataaatccactgatttacacaatctttaatgaagacttcaagaaagcattccaaaag
cttgtgcgatgtcgatgttag

KEGG   Homo sapiens (human): 3356
Entry
3356              CDS       T01001                                 

Gene name
HTR2A, 5-HT2A, HTR2
Definition
(RefSeq) 5-hydroxytryptamine receptor 2A
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
Disease
H01450  Obsessive-compulsive disorder
H01611  Alcohol dependence
H01646  Major depressive disorder
H01649  Schizophrenia
Drug target
Adatanserin hydrochloride: D02767
Altanserin tartrate: D02836
Amesergide: D02893
Aripiprazole (DG00906): D01164<JP/US> D10355 D10364<US> D10516<JP/US>
Asenapine (DG03100): D02995<JP/US> D11769<US>
Atiprosin maleate: D03005
Blonanserin: D01176<JP>
Brexpiprazole: D10309<JP/US>
Cariprazine (DG01305): D09876<US> D09997
Chlorpromazine (DG00867): D00270 D00789<JP/US> D03274 D04034<JP> D09819
Cinanserin hydrochloride: D03506
Cinitapride (DG01520): D07700 D07701
Cisapride (DG00056): D00274 D02092
Clozapine: D00283<JP/US>
Cyamemazine (DG00872): D07307 D07756
Dimetotiazine (DG00843): D01902<JP> D07854
Eplivanserin: D10006
Esmirtazapine maleate: D04055
Fananserin: D02656
Fenfluramine (DG00103): D04148 D07945<US>
Flibanserin: D02577<US>
Glemanserin: D04320
Iloperidone: D02666<US>
Ketanserin (DG00265): D02363 D08099
Loxapine (DG00897): D00794<US> D02340<US> D08148
Lubazodone hydrochloride: D04788
Lumateperone (DG02937): D11169 D11170<US>
Lurasidone: D04820<JP/US>
Mesoridazine (DG00883): D00795 D02671
Methysergide (DG00835): D00681 D02357
Metrenperone: D05015
Mirtazapine (DG02838): D00563<JP/US> D11056
Naftidrofuryl (DG00290): D05107 D08244
Nefazodone (DG00953): D00819<US> D08257
Nelotanserin: D09645
Ocaperidone: D02675
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Opipramol (DG00930): D01477 D08297
Paliperidone (DG00907): D05339<JP/US> D05340<JP/US>
Pelanserin hydrochloride: D05395
Periciazine: D01485<JP>
Perospirone hydrochloride hydrate: D02372<JP>
Pimavanserin: D08969<US>
Pipotiazine (DG00884): D02680 D08385
Pizotifen (DG00842): D05523 D08397
Pruvanserin (DG01278): D06632 D06633
Quetiapine (DG00899): D00458<JP/US> D08456
Risperidone: D00426<JP/US>
Ritanserin: D05738
Sarpogrelate (DG01333): D01624<JP> D08508
Sergolexole maleate: D05829
Sertindole: D00561
Setoperone: D02686
Temanogrel (DG01334): D09976 D09977
Tiospirone hydrochloride: D02688
Trazodone (DG00952): D00820<JP/US> D08626
Tropanserin hydrochloride: D06253
Xylamidine tosylate: D06343
Zicronapine (DG01539): D10329 D10495
Ziprasidone (DG00892): D01939<US> D02100<US> D08687
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3356 (HTR2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3356 (HTR2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    3356 (HTR2A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3356 (HTR2A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3356 (HTR2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3356 (HTR2A)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3356 (HTR2A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Other DBs
NCBI-GeneID: 3356
NCBI-ProteinID: NP_000612
OMIM: 182135
HGNC: 5293
Ensembl: ENSG00000102468
Vega: OTTHUMG00000016881
Pharos: P28223(Tclin)
UniProt: P28223
LinkDB
Position
13q14.2
AA seq 471 aa
MDILCEENTSLSSTTNSLMQLNDDTRLYSNDFNSGEANTSDAFNWTVDSENRTNLSCEGC
LSPSCLSLLHLQEKNWSALLTAVVIILTIAGNILVIMAVSLEKKLQNATNYFLMSLAIAD
MLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVLFSTASIMHLCAISLDRYVAIQNP
IHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQDDSKVFKEGSCLLADDNFVLIGSF
VSFFIPLTIMVITYFLTIKSLQKEATLCVSDLGTRAKLASFSFLPQSSLSSEKLFQRSIH
REPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWCPFFITNIMAVICKESCNEDVIGA
LLNVFVWIGYLSSAVNPLVYTLFNKTYRSAFSRYIQCQYKENKKPLQLILVNTIPALAYK
SSQLQMGQKKNSKQDAKTTDNDCSMVALGKQHSEEASKDNSDGVNEKVSCV
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggatattctttgtgaagaaaatacttctttgagctcaactacgaactccctaatgcaa
ttaaatgatgacaccaggctctacagtaatgactttaactccggagaagctaacacttct
gatgcatttaactggacagtcgactctgaaaatcgaaccaacctttcctgtgaagggtgc
ctctcaccgtcgtgtctctccttacttcatctccaggaaaaaaactggtctgctttactg
acagccgtagtgattattctaactattgctggaaacatactcgtcatcatggcagtgtcc
ctagagaaaaagctgcagaatgccaccaactatttcctgatgtcacttgccatagctgat
atgctgctgggtttccttgtcatgcccgtgtccatgttaaccatcctgtatgggtaccgg
tggcctctgccgagcaagctttgtgcagtctggatttacctggacgtgctcttctccacg
gcctccatcatgcacctctgcgccatctcgctggaccgctacgtcgccatccagaatccc
atccaccacagccgcttcaactccagaactaaggcatttctgaaaatcattgctgtttgg
accatatcagtaggtatatccatgccaataccagtctttgggctacaggacgattcgaag
gtctttaaggaggggagttgcttactcgccgatgataactttgtcctgatcggctctttt
gtgtcatttttcattcccttaaccatcatggtgatcacctactttctaactatcaagtca
ctccagaaagaagctactttgtgtgtaagtgatcttggcacacgggccaaattagcttct
ttcagcttcctccctcagagttctttgtcttcagaaaagctcttccagcggtcgatccat
agggagccagggtcctacacaggcaggaggactatgcagtccatcagcaatgagcaaaag
gcatgcaaggtgctgggcatcgtcttcttcctgtttgtggtgatgtggtgccctttcttc
atcacaaacatcatggccgtcatctgcaaagagtcctgcaatgaggatgtcattggggcc
ctgctcaatgtgtttgtttggatcggttatctctcttcagcagtcaacccactagtctac
acactgttcaacaagacctataggtcagccttttcacggtatattcagtgtcagtacaag
gaaaacaaaaaaccattgcagttaattttagtgaacacaataccggctttggcctacaag
tctagccaacttcaaatgggacaaaaaaagaattcaaagcaagatgccaagacaacagat
aatgactgctcaatggttgctctaggaaagcagcattctgaagaggcttctaaagacaat
agcgacggagtgaatgaaaaggtgagctgtgtgtga

KEGG   Homo sapiens (human): 3357
Entry
3357              CDS       T01001                                 

Gene name
HTR2B, 5-HT(2B), 5-HT-2B, 5-HT2B
Definition
(RefSeq) 5-hydroxytryptamine receptor 2B
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Adatanserin hydrochloride: D02767
Chlorpromazine (DG00867): D00270 D00789<JP/US> D03274 D04034<JP> D09819
Cinitapride (DG01520): D07700 D07701
Dimetotiazine (DG00843): D01902<JP> D07854
Fenfluramine (DG00103): D04148 D07945<US>
Flibanserin: D02577<US>
Glemanserin: D04320
Iloperidone: D02666<US>
Methysergide (DG00835): D00681 D02357
Metrenperone: D05015
Mirtazapine (DG02838): D00563<JP/US> D11056
Ocaperidone: D02675
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Opipramol (DG00930): D01477 D08297
Pelanserin hydrochloride: D05395
Periciazine: D01485<JP>
Pizotifen (DG00842): D05523 D08397
Sergolexole maleate: D05829
Setoperone: D02686
Tiospirone hydrochloride: D02688
Trazodone (DG00952): D00820<JP/US> D08626
Tropanserin hydrochloride: D06253
Xylamidine tosylate: D06343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3357 (HTR2B)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3357 (HTR2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    3357 (HTR2B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3357 (HTR2B)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3357 (HTR2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3357 (HTR2B)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3357 (HTR2B)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srv 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 3357
NCBI-ProteinID: NP_000858
OMIM: 601122
HGNC: 5294
Ensembl: ENSG00000135914
Vega: OTTHUMG00000133222
Pharos: P41595(Tclin)
UniProt: P41595
LinkDB
Position
2q37.1
AA seq 481 aa
MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALL
ILMVIIPTIGGNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAM
WPLPLVLCPAWLFLDVLFSTASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVW
LISIGIAIPVPIKGIETDVDNPNNITCVLTKERFGDFMLFGSLAAFFTPLAIMIVTYFLT
IHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDET
LMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLCDSCNQTTLQM
LLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSY
V
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggctctctcttacagagtgtctgaacttcaaagcacaattcctgagcacattttgcag
agcacctttgttcacgttatctcttctaactggtctggattacagacagaatcaatacca
gaggaaatgaaacagattgttgaggaacagggaaataaactgcactgggcagctcttctg
atactcatggtgataatacccacaattggtggaaatacccttgttattctggctgtttca
ctggagaagaagctgcagtatgctactaattactttctaatgtccttggcggtggctgat
ttgctggttggattgtttgtgatgccaattgccctcttgacaataatgtttgaggctatg
tggcccctcccacttgttctatgtcctgcctggttatttcttgacgttctcttttcaacc
gcatccatcatgcatctctgtgccatttcagtggatcgttacatagccatcaaaaagcca
atccaggccaatcaatataactcacgggctacagcattcatcaagattacagtggtgtgg
ttaatttcaataggcattgccattccagtccctattaaagggatagagactgatgtggac
aacccaaacaatatcacttgtgtgctgacaaaggaacgttttggcgatttcatgctcttt
ggctcactggctgccttcttcacacctcttgcaattatgattgtcacctactttctcact
atccatgctttacagaagaaggcttacttagtcaaaaacaagccacctcaacgcctaaca
tggttgactgtgtctacagttttccaaagggatgaaacaccttgctcgtcaccggaaaag
gtggcaatgctggatggttctcgaaaggacaaggctctgcccaactcaggtgatgaaaca
cttatgcgaagaacatccacaattgggaaaaagtcagtgcagaccatttccaacgaacag
agagcctcaaaggtcctagggattgtgtttttcctctttttgcttatgtggtgtcccttc
tttattacaaatataactttagttttatgtgattcctgtaaccaaactactctccaaatg
ctcctggagatatttgtgtggataggctatgtttcctcaggagtgaatcctttggtctac
accctcttcaataagacatttcgggatgcatttggccgatatatcacctgcaattaccgg
gccacaaagtcagtaaaaactctcagaaaacgctccagtaagatctacttccggaatcca
atggcagagaactctaagtttttcaagaaacatggaattcgaaatgggattaaccctgcc
atgtaccagagtccaatgaggctccgaagttcaaccattcagtcttcatcaatcattcta
ctagatacgcttctcctcactgaaaatgaaggtgacaaaactgaagagcaagttagttat
gtatag

KEGG   Homo sapiens (human): 3358
Entry
3358              CDS       T01001                                 

Gene name
HTR2C, 5-HT1C, 5-HT2C, 5-HTR2C, 5HTR2C, HTR1C
Definition
(RefSeq) 5-hydroxytryptamine receptor 2C
  KO
K04157  5-hydroxytryptamine receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04540  Gap junction
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
Drug target
Adatanserin hydrochloride: D02767
Agomelatine: D02578
Amesergide: D02893
Asenapine (DG03100): D02995<JP/US>
Captodiame: D07316
Chlorpromazine (DG00867): D00270 D00789<JP/US> D03274 D04034<JP> D09819
Cinanserin hydrochloride: D03506
Cinitapride (DG01520): D07700 D07701
Clozapine: D00283<JP/US>
Cyamemazine (DG00872): D07307 D07756
Dimetotiazine (DG00843): D01902<JP> D07854
Fenfluramine (DG00103): D04148 D07945<US>
Flibanserin: D02577<US>
Glemanserin: D04320
Idalopirdine (DG01878): D10710
Iloperidone: D02666<US>
Lorcaserin (DG03052): D06613 D11566<US>
Methysergide (DG00835): D00681 D02357
Metrenperone: D05015
Mirtazapine (DG02838): D00563<JP/US> D11056
Nefazodone (DG00953): D00819<US> D08257
Ocaperidone: D02675
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Opipramol (DG00930): D01477 D08297
Pelanserin hydrochloride: D05395
Periciazine: D01485<JP>
Pimavanserin: D08969<US>
Pizotifen (DG00842): D05523 D08397
Ritanserin: D05738
Sergolexole maleate: D05829
Setoperone: D02686
Tedatioxetine (DG01311): D10170 D10171
Tiospirone hydrochloride: D02688
Trazodone (DG00952): D00820<JP/US> D08626
Tropanserin hydrochloride: D06253
Vabicaserin hydrochloride: D06660
Xylamidine tosylate: D06343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3358 (HTR2C)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3358 (HTR2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    3358 (HTR2C)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3358 (HTR2C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3358 (HTR2C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3358 (HTR2C)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3358 (HTR2C)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx DUF1385 UPF0182 Pox_P21
Other DBs
NCBI-GeneID: 3358
NCBI-ProteinID: NP_000859
OMIM: 312861
HGNC: 5295
Ensembl: ENSG00000147246
Vega: OTTHUMG00000022226
Pharos: P28335(Tclin)
UniProt: P28335
LinkDB
Position
Xq23
AA seq 458 aa
MVNLRNAVHSFLVHLIGLLVWQCDISVSPVAAIVTDIFNTSDGGRFKFPDGVQNWPALSI
VIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAILYDYVW
PLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWA
ISIGVSVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYV
LRRQALMLLHGHTEEPPGLSLDFLKCCKRNTAEEENSANPNQDQNARRRKKKERRPRGTM
QAINNERKASKVLGIVFFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVC
SGINPLVYTLFNKIYRRAFSNYLRCNYKVEKKPPVRQIPRVAATALSGRELNVNIYRHTN
EPVIEKASDNEPGIEMQVENLELPVNPSSVVSERISSV
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggtgaacctgaggaatgcggtgcattcattccttgtgcacctaattggcctattggtt
tggcaatgtgatatttctgtgagcccagtagcagctatagtaactgacattttcaatacc
tccgatggtggacgcttcaaattcccagacggggtacaaaactggccagcactttcaatc
gtcatcataataatcatgacaataggtggcaacatccttgtgatcatggcagtaagcatg
gaaaagaaactgcacaatgccaccaattacttcttaatgtccctagccattgctgatatg
ctagtgggactacttgtcatgcccctgtctctcctggcaatcctttatgattatgtctgg
ccactacctagatatttgtgccccgtctggatttctttagatgttttattttcaacagcg
tccatcatgcacctctgcgctatatcgctggatcggtatgtagcaatacgtaatcctatt
gagcatagccgtttcaattcgcggactaaggccatcatgaagattgctattgtttgggca
atttctataggtgtatcagttcctatccctgtgattggactgagggacgaagaaaaggtg
ttcgtgaacaacacgacgtgcgtgctcaacgacccaaatttcgttcttattgggtccttc
gtagctttcttcataccgctgacgattatggtgattacgtattgcctgaccatctacgtt
ctgcgccgacaagctttgatgttactgcacggccacaccgaggaaccgcctggactaagt
ctggatttcctgaagtgctgcaagaggaatacggccgaggaagagaactctgcaaaccct
aaccaagaccagaacgcacgccgaagaaagaagaaggagagacgtcctaggggcaccatg
caggctatcaacaatgaaagaaaagcttcgaaagtccttgggattgttttctttgtgttt
ctgatcatgtggtgcccatttttcattaccaatattctgtctgttctttgtgagaagtcc
tgtaaccaaaagctcatggaaaagcttctgaatgtgtttgtttggattggctatgtttgt
tcaggaatcaatcctctggtgtatactctgttcaacaaaatttaccgaagggcattctcc
aactatttgcgttgcaattataaggtagagaaaaagcctcctgtcaggcagattccaaga
gttgccgccactgctttgtctgggagggagcttaatgttaacatttatcggcataccaat
gaaccggtgatcgagaaagccagtgacaatgagcccggtatagagatgcaagttgagaat
ttagagttaccagtaaatccctccagtgtggttagcgaaaggattagcagtgtgtga

KEGG   Homo sapiens (human): 3360
Entry
3360              CDS       T01001                                 

Gene name
HTR4, 5-HT4, 5-HT4R
Definition
(RefSeq) 5-hydroxytryptamine receptor 4
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
Drug target
Cinitapride (DG01520): D07700 D07701
Cisapride (DG00056): D00274 D02092
Fabesetron hydrochloride: D01838
Mosapride (DG01285): D01994<JP> D08236
Naronapride (DG01335): D09933 D09934
Piboserod hydrochloride: D05471
Prucalopride (DG00080): D09205 D10152<US>
Relenopride (DG02948): D11220 D11221
Renzapride: D06396
Sulamserod hydrochloride: D05941
Tegaserod (DG00081): D02730<US> D06056
Velusetrag (DG01336): D09693 D09694
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3360 (HTR4)
   04024 cAMP signaling pathway
    3360 (HTR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3360 (HTR4)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3360 (HTR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3360 (HTR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3360 (HTR4)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 3360
NCBI-ProteinID: NP_000861
OMIM: 602164
HGNC: 5299
Ensembl: ENSG00000164270
Vega: OTTHUMG00000129931
Pharos: Q13639(Tclin)
UniProt: Q13639 A0A2D3FAF9
LinkDB
Position
5q32
AA seq 388 aa
MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIV
SLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYY
AICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSN
STYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRP
QSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWL
GYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRD
AVECGGQWESQCHPPATSPLVAAQPSDT
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggacaaacttgatgctaatgtgagttctgaggagggtttcgggtcagtggagaaggtg
gtgctgctcacgtttctctcgacggttatcctgatggccatcttggggaacctgctggtg
atggtggctgtgtgctgggacaggcagctcaggaaaataaaaacaaattatttcattgta
tctcttgcttttgcggatctgctggtttcggtgctggtgatgccctttggtgccattgag
ctggttcaagacatctggatttatggggaggtgttttgtcttgttcggacatctctggac
gtcctgctcacaacggcatcgatttttcacctgtgctgcatttctctggataggtattac
gccatctgctgccagcctttggtctataggaacaagatgacccctctgcgcatcgcatta
atgctgggaggctgctgggtcatccccacgtttatttcttttctccctataatgcaaggc
tggaataacattggcataattgatttgatagaaaagaggaagttcaaccagaactctaac
tctacgtactgtgtcttcatggtcaacaagccctacgccatcacctgctctgtggtggcc
ttctacatcccatttctcctcatggtgctggcctattaccgcatctatgtcacagctaag
gagcatgcccatcagatccagatgttacaacgggcaggagcctcctccgagagcaggcct
cagtcggcagaccagcatagcactcatcgcatgaggacagagaccaaagcagccaagacc
ctgtgcatcatcatgggttgcttctgcctctgctgggcaccattctttgtcaccaatatt
gtggatcctttcatagactacactgtccctgggcaggtgtggactgctttcctctggctc
ggctatatcaattccgggttgaacccttttctctacgccttcttgaataagtcttttaga
cgtgccttcctcatcatcctctgctgtgatgatgagcgctaccgaagaccttccattctg
ggccagactgtcccttgttcaaccacaaccattaatggatccacacatgtactaagggat
gcagtggagtgtggtggccagtgggagagtcagtgtcacccgccagcaacttctcctttg
gtggctgctcagcccagtgacacttag

KEGG   Homo sapiens (human): 3361
Entry
3361              CDS       T01001                                 

Gene name
HTR5A, 5-HT5A
Definition
(RefSeq) 5-hydroxytryptamine receptor 5A
  KO
K04161  5-hydroxytryptamine receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3361 (HTR5A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3361 (HTR5A)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3361 (HTR5A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3361 (HTR5A)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3361 (HTR5A)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 3361
NCBI-ProteinID: NP_076917
OMIM: 601305
HGNC: 5300
Ensembl: ENSG00000157219
Vega: OTTHUMG00000151327
Pharos: P47898(Tchem)
UniProt: P47898 A4D2N2
LinkDB
Position
7q36.2
AA seq 357 aa
MDLPVNLTSFSLSTPSPLETNHSLGKDDLRPSSPLLSVFGVLILTLLGFLVAATFAWNLL
VLATILRVRTFHRVPHNLVASMAVSDVLVAALVMPLSLVHELSGRRWQLGRRLCQLWIAC
DVLCCTASIWNVTAIALDRYWSITRHMEYTLRTRKCVSNVMIALTWALSAVISLAPLLFG
WGETYSEGSEECQVSREPSYAVFSTVGAFYLPLCVVLFVYWKIYKAAKFRVGSRKTNSVS
PISEAVEVKDSAKQPQMVFTVRHATVTFQPEGDTWREQKEQRAALMVGILIGVFVLCWIP
FFLTELISPLCSCDIPAIWKSIFLWLGYSNSFFNPLIYTAFNKNYNSAFKNFFSRQH
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggatttacctgtgaacctaacctccttttccctctccaccccctcccctttggagacc
aaccacagcctcggcaaagacgacctgcgccccagctcgcccctgctctcggtcttcgga
gtgcttattctcaccttgctgggctttctggtggcggcgacgttcgcctggaacctgctg
gtgctggcgaccatcctccgtgtacgcaccttccaccgcgtgccccacaacctggtggca
tccatggccgtctcggatgtcctggtggccgcgctggtcatgccgctgagcctggtgcac
gagctgtccgggcgccgctggcagctaggtcggaggctgtgccagctttggatcgcgtgc
gacgtgctttgctgcacggccagcatctggaacgtgacggccatagccctggaccgctac
tggtccatcacgcgccacatggaatacacgctccgcacccgcaagtgcgtctccaacgtc
atgatcgcgctcacctgggcactctccgctgtcatctctctggccccgctgctttttggc
tggggagagacgtactctgagggcagcgaggagtgccaggtaagccgcgagccttcctac
gccgtgttctccaccgtaggcgccttctacctgccgctctgtgtggtgctcttcgtgtac
tggaagatctacaaggctgccaagttccgcgtgggctccaggaagaccaatagcgtctca
cccatatccgaagctgtggaggtgaaggactctgccaaacagccccagatggtgttcacg
gtccgccacgccaccgtcaccttccagccagaaggggacacgtggcgggagcagaaggag
cagcgggccgccctcatggtgggcatcctcattggcgtgttcgtgctctgctggatcccc
ttctttctcaccgagctcatcagtcccctctgctcctgtgacatccccgccatctggaaa
agcatcttcctgtggcttggctactccaactccttctttaaccccctgatctatacggct
ttcaacaagaactacaacagcgccttcaagaacttcttttctaggcaacactga

KEGG   Homo sapiens (human): 3362
Entry
3362              CDS       T01001                                 

Gene name
HTR6, 5-HT6, 5-HT6R
Definition
(RefSeq) 5-hydroxytryptamine receptor 6
  KO
K04162  5-hydroxytryptamine receptor 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
Drug target
Asenapine (DG03100): D02995<JP/US>
Cerlapirdine (DG01337): D10099 D10100
Idalopirdine (DG01878): D10710 D10747
Olanzapine (DG00898): D00454<JP/US> D06623<US>
Tiospirone hydrochloride: D02688
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    3362 (HTR6)
   04024 cAMP signaling pathway
    3362 (HTR6)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3362 (HTR6)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3362 (HTR6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3362 (HTR6)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3362 (HTR6)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Other DBs
NCBI-GeneID: 3362
NCBI-ProteinID: NP_000862
OMIM: 601109
HGNC: 5301
Ensembl: ENSG00000158748
Vega: OTTHUMG00000002713
Pharos: P50406(Tchem)
UniProt: P50406
LinkDB
Position
1p36.13
AA seq 440 aa
MVPEPGPTANSTPAWGAGPPSAPGGSGWVAAALCVVIALTAAANSLLIALICTQPALRNT
SNFFLVSLFTSDLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLI
SLDRYLLILSPLRYKLRMTPLRALALVLGAWSLAALASFLPLLLGWHELGHARPPVPGQC
RLLASLPFVLVASGLTFFLPSGAICFTYCRILLAARKQAVQVASLTTGMASQASETLQVP
RTPRPGVESADSRRLATKHSRKALKASLTLGILLGMFFVTWLPFFVANIVQAVCDCISPG
LFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFLPCPRCPRERQASLASPSLRTSHSGP
RPGLSLQQVLPLPLPPDSDSDSDAGSGGSSGLRLTAQLLLPGEATQDPPLPTRAAAAVNF
FNIDPAEPELRPHPLGIPTN
NT seq 1323 nt   +upstreamnt  +downstreamnt
atggtcccagagccgggcccaaccgccaatagcaccccggcctggggggcagggccgccg
tcggccccggggggcagcggctgggtggcggccgcgctgtgcgtggtcatcgcgctgacg
gcggcggccaactcgctgctgatcgcgctcatctgcactcagcccgcgctgcgcaacacg
tccaacttcttcctggtgtcgctcttcacgtctgacctgatggtggggctggtggtgatg
ccgccggccatgctgaacgcgctgtacgggcgctgggtgctggcgcgcggcctctgcctg
ctctggaccgccttcgacgtgatgtgctgcagcgcctccatcctcaacctctgcctcatc
agcctggaccgctacctgctcatcctctcgccgctgcgctacaagctgcgcatgacgccc
ctgcgtgccctggccctagtcctgggcgcctggagcctcgccgctctcgcctccttcctg
cccctgctgctgggctggcacgagctgggccacgcacggccacccgtccctggccagtgc
cgcctgctggccagcctgccttttgtccttgtggcgtcgggcctcaccttcttcctgccc
tcgggtgccatatgcttcacctactgcaggatcctgctagctgcccgcaagcaggccgtg
caggtggcctccctcaccaccggcatggccagtcaggcctcggagacgctgcaggtgccc
aggaccccacgcccaggggtggagtctgctgacagcaggcgtctagccacgaagcacagc
aggaaggccctgaaggccagcctgacgctgggcatcctgctgggcatgttctttgtgacc
tggttgcccttctttgtggccaacatagtccaggccgtgtgcgactgcatctccccaggc
ctcttcgatgtcctcacatggctgggttactgtaacagcaccatgaaccccatcatctac
ccactcttcatgcgggacttcaagcgggcgctgggcaggttcctgccatgtccacgctgt
ccccgggagcgccaggccagcctggcctcgccatcactgcgcacctctcacagcggcccc
cggcccggccttagcctacagcaggtgctgccgctgcccctgccgccggactcagattcg
gactcagacgcaggctcaggcggctcctcgggcctgcggctcacggcccagctgctgctt
cctggcgaggccacccaggaccccccgctgcccaccagggccgctgccgccgtcaatttc
ttcaacatcgaccccgcggagcccgagctgcggccgcatccacttggcatccccacgaac
tga

KEGG   Homo sapiens (human): 3363
Entry
3363              CDS       T01001                                 

Gene name
HTR7, 5-HT7
Definition
(RefSeq) 5-hydroxytryptamine receptor 7
  KO
K04163  5-hydroxytryptamine receptor 7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04726  Serotonergic synapse
Drug target
Asenapine (DG03100): D02995<JP/US>
Methysergide (DG00835): D00681 D02357
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    3363 (HTR7)
   04020 Calcium signaling pathway
    3363 (HTR7)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    3363 (HTR7)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    3363 (HTR7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    3363 (HTR7)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    3363 (HTR7)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 3363
NCBI-ProteinID: NP_062873
OMIM: 182137
HGNC: 5302
Ensembl: ENSG00000148680
Vega: OTTHUMG00000018732
Pharos: P34969(Tclin)
UniProt: P34969
LinkDB
Position
10q23.31
AA seq 479 aa
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgatggacgttaacagcagcggccgcccggacctctacgggcacctccgctctttcctt
ctgccagaagtggggcgcgggctgcccgacttgagccccgacggtggcgccgacccggtc
gcgggctcctgggcgccgcacctgctgagcgaggtgacagccagcccggcgcccacctgg
gacgcgcccccggacaatgcctccggctgtggggaacagatcaactacggcagagtcgag
aaagttgtgatcggctccatcctgacgctcatcacgctgctgacgatcgcgggcaactgc
ctggtggtgatctccgtgtgcttcgtcaagaagctccgccagccctccaactacctgatc
gtgtccctggcgctggccgacctctcggtggctgtggcggtcatgcccttcgtcagcgtc
accgacctcatcgggggcaagtggatctttggacactttttctgtaatgtcttcatcgcc
atggacgtcatgtgctgcacggcctcgatcatgaccctgtgcgtgatcagcattgacagg
taccttgggatcacaaggcccctcacataccctgtgaggcagaatgggaaatgcatggcg
aagatgattctctccgtctggcttctctccgcctccatcaccttacctccactctttgga
tgggctcagaatgtaaatgatgataaggtgtgcttgatcagccaggactttggctatacg
atttactctaccgcagtggcattttatatccccatgtccgtcatgcttttcatgtactac
cagatttacaaggctgccaggaagagtgctgccaaacacaagtttcctggcttccctcga
gtggagccagacagcgtcatcgccctgaatggcatagtgaagctccagaaggaggtggaa
gagtgtgcaaacctttcgagactcctcaagcatgaaaggaaaaacatctccatctttaag
cgagaacagaaagcagccaccaccctggggatcatcgtcggggcctttaccgtgtgctgg
ctgccatttttcctcctctcgacagccagacccttcatctgtggcacttcctgcagctgc
atcccactgtgggtggagaggacatttctgtggctaggctatgcaaactctctcattaac
ccttttatatatgccttcttcaaccgggacctgaggaccacctatcgcagcctgctccag
tgccagtaccggaatatcaaccggaagctctcagctgcaggcatgcatgaagccctgaag
cttgctgagaggccagagagacctgagtttgtgctgagggcctgcacaaggagggtgctg
ttgagaccagaaaagaggccaccggtatctgtgtgggtgctacaatctccagaccatcac
aattggttagcagacaaaatgctgactactgtagaaaaaaaggtcatgattcatgattga

DBGET integrated database retrieval system