KEGG   Homo sapiens (human): 3364Help
Entry
3364              CDS       T01001                                 

Gene name
HUS1, hHUS1
Definition
(RefSeq) HUS1 checkpoint clamp component
  KO
K10903  HUS1 checkpoint protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3364 (HUS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    3364 (HUS1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  Check point factors
   Rad9-Hus1-Rad1 complex
    3364 (HUS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hus1
Motif
Other DBs
NCBI-GeneID: 3364
NCBI-ProteinID: NP_004498
OMIM: 603760
HGNC: 5309
Ensembl: ENSG00000136273
Vega: OTTHUMG00000155645
Pharos: O60921(Tbio)
UniProt: O60921 A4D2F2
LinkDB All DBs
Structure
PDB: 

Position
7p12.3
AA seq 280 aa AA seqDB search
MKFRAKIVDGACLNHFTRISNMIAKLAKTCTLRISPDKLNFILCDKLANGGVSMWCELEQ
ENFFNEFQMEGVSAENNEIYLELTSENLSRALKTAQNARALKIKLTNKHFPCLTVSVELL
SMSSSSRIVTHDIPIKVIPRKLWKDLQEPVVPDPDVSIYLPVLKTMKSVVEKMKNISNHL
VIEANLDGELNLKIETELVCVTTHFKDLGNPPLASESTHEDRNVEHMAEVHIDIRKLLQF
LAGQQVNPTKALCNIVNNKMVHFDLLHEDVSLQYFIPALS
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttcgggccaagatcgtggacggggcctgtctgaaccacttcacacgaatcagt
aacatgatagccaagcttgccaaaacctgcaccctccgcatcagccctgataagcttaac
ttcatcctttgtgacaagctggctaatggaggagtgagcatgtggtgtgagctggaacag
gagaacttcttcaacgaatttcaaatggagggtgtctctgcagaaaacaatgagatttat
ttagagctaacatcggaaaacttatctcgagccttgaagactgcccagaatgccagggct
ttgaaaatcaaactgactaataaacactttccctgcctcacggtctccgtggagctgtta
tctatgtcaagcagtagccgcattgtgacccatgacatccccataaaggtgattcctagg
aaattgtggaaggacttacaagaaccggtggtcccagatcctgatgttagtatttattta
ccagtcttgaagactatgaagagtgttgtggaaaaaatgaaaaacatcagcaatcacctt
gttattgaagcaaacctagatggagaattgaatttgaaaatagaaactgaattagtatgt
gttacaactcattttaaagatcttggaaatcctccattagcctctgaaagcacccatgag
gacagaaacgtggaacacatggctgaagtgcacatagatattaggaagctcctacagttt
cttgctggacaacaagtaaatcccacaaaggccttatgcaatattgtgaataacaagatg
gtgcattttgatctgcttcatgaagacgtgtcccttcagtatttcatccctgcgctgtcc
tag

DBGET integrated database retrieval system