KEGG   Homo sapiens (human): 338382Help
Entry
338382            CDS       T01001                                 

Gene name
RAB7B, RAB7
Definition
(RefSeq) RAB7B, member RAS oncogene family
  KO
K07898  Ras-related protein Rab-7B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04145  Phagosome
hsa05132  Salmonella infection
hsa05146  Amoebiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    338382 (RAB7B)
   04140 Autophagy - animal
    338382 (RAB7B)
   04137 Mitophagy - animal
    338382 (RAB7B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    338382 (RAB7B)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    338382 (RAB7B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    338382 (RAB7B)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    338382 (RAB7B)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    338382 (RAB7B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    338382 (RAB7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 ATP_bind_1 cobW AAA_22 VirE AAA_16 Septin AAA_5 AAA AAA_7
Motif
Other DBs
NCBI-GeneID: 338382
NCBI-ProteinID: NP_001157994
HGNC: 30513
Ensembl: ENSG00000276600
Vega: OTTHUMG00000189246
Pharos: Q96AH8(Tbio)
UniProt: Q96AH8
LinkDB All DBs
Position
1q32.1
AA seq 199 aa AA seqDB search
MNPRKKVDLKLIIVGAIGVGKTSLLHQYVHKTFYEEYQTTLGASILSKIIILGDTTLKLQ
IWDTGGQERFRSMVSTFYKGSDGCILAFDVTDLESFEALDIWRGDVLAKIVPMEQSYPMV
LLGNKIDLADRKVPQEVAQGWCREKDIPYFEVSAKNDINVVQAFEMLASRALSRYQSILE
NHLTESIKLSPDQSRSRCC
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgaatccccggaagaaggtggacctgaaactcattatcgtcggagccattggtgtggga
aagacctccctccttcaccaatatgtgcacaagacgttttatgaggaataccagaccaca
ctgggggccagcatcctctccaagattatcatattgggtgacacaactttgaagttacag
atctgggacacgggcggtcaggagcggttccgctccatggtgtccacgttctacaagggc
tccgatggctgcatcctagcttttgatgtcaccgacctggagtcttttgaagccctggat
atctggcggggtgatgtcctggccaagattgtccccatggagcagtcctaccccatggtg
ttgttggggaacaagatcgatctggcagaccggaaggtaccccaggaagtagctcaaggc
tggtgtagagagaaagatattccttactttgaagtcagtgccaagaatgacatcaatgtg
gtgcaagcgtttgagatgctggccagtagggctctgtcgaggtaccagagcatcttagaa
aatcacctcacagaatccatcaagctctcgccagaccagtcaaggagcagatgctgctga

KEGG   Homo sapiens (human): 7879Help
Entry
7879              CDS       T01001                                 

Gene name
RAB7A, CMT2B, PRO2706, RAB7
Definition
(RefSeq) RAB7A, member RAS oncogene family
  KO
K07897  Ras-related protein Rab-7A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04145  Phagosome
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05152  Tuberculosis
Disease
H00264  Charcot-Marie-Tooth disease
H00265  Hereditary sensory and autonomic neuropathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    7879 (RAB7A)
   04145 Phagosome
    7879 (RAB7A)
   04140 Autophagy - animal
    7879 (RAB7A)
   04137 Mitophagy - animal
    7879 (RAB7A)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    7879 (RAB7A)
   05152 Tuberculosis
    7879 (RAB7A)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    7879 (RAB7A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7879 (RAB7A)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7879 (RAB7A)
   04031 GTP-binding proteins [BR:hsa04031]
    7879 (RAB7A)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab GTPases
    7879 (RAB7A)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7879 (RAB7A)
  Exosomal proteins of other body fluids (saliva and urine)
   7879 (RAB7A)
  Exosomal proteins of colorectal cancer cells
   7879 (RAB7A)
  Exosomal proteins of bladder cancer cells
   7879 (RAB7A)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    7879 (RAB7A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf MMR_HSR1 RsgA_GTPase Gtr1_RagA GTP_EFTU cobW ATP_bind_1 Septin AAA_22 PduV-EutP AAA_7 SRPRB AAA_24 AAA_16 NTPase_1 AAA_5 G-alpha TniB ATPase_2 NB-ARC NACHT
Motif
Other DBs
NCBI-GeneID: 7879
NCBI-ProteinID: NP_004628
OMIM: 602298
HGNC: 9788
Ensembl: ENSG00000075785
Vega: OTTHUMG00000159812
Pharos: P51149(Tbio)
UniProt: P51149 A0A158RFU6
LinkDB All DBs
Structure
PDB: 

Position
3q21.3
AA seq 207 aa AA seqDB search
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRAKASAESCSC
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagtcggg
aagacatcactcatgaaccagtatgtgaataagaaattcagcaatcagtacaaagccaca
ataggagctgactttctgaccaaggaggtgatggtggatgacaggctagtcacaatgcag
atatgggacacagcaggacaggaacggttccagtctctcggtgtggccttctacagaggt
gcagactgctgcgttctggtatttgatgtgactgcccccaacacattcaaaaccctagat
agctggagagatgagtttctcatccaggccagtccccgagatcctgaaaacttcccattt
gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag
gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc
aacgtggagcaggcgttccagacgattgcacggaatgcacttaagcaggaaacggaggtg
gagctgtacaacgaatttcctgaacctatcaaactggacaagaatgaccgggccaaggcc
tcggcagaaagctgcagttgctga

DBGET integrated database retrieval system