KEGG   Homo sapiens (human): 339221Help
Entry
339221            CDS       T01001                                 

Gene name
ENPP7, ALK-SMase, E-NPP_7, NPP-7, NPP7
Definition
(RefSeq) ectonucleotide pyrophosphatase/phosphodiesterase 7
  KO
K12354  ectonucleotide pyrophosphatase/phosphodiesterase family member 7 [EC:3.1.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    339221 (ENPP7)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     339221 (ENPP7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Phosphodiest Sulfatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 339221
NCBI-ProteinID: NP_848638
OMIM: 616997
HGNC: 23764
Ensembl: ENSG00000182156
Vega: OTTHUMG00000177462
Pharos: Q6UWV6(Tbio)
UniProt: Q6UWV6
LinkDB All DBs
Structure
PDB: 

Position
17q25.3
AA seq 458 aa AA seqDB search
MRGPAVLLTVALATLLAPGAGAPVQSQGSQNKLLLVSFDGFRWNYDQDVDTPNLDAMARD
GVKARYMTPAFVTMTSPCHFTLVTGKYIENHGVVHNMYYNTTSKVKLPYHATLGIQRWWD
NGSVPIWITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANIDTVM
AWFTEEDLDLVTLYFGEPDSTGHRYGPESPERREMVRQVDRTVGYLRESIARNHLTDRLN
LIITSDHGMTTVDKRAGDLVEFHKFPNFTFRDIEFELLDYGPNGMLLPKEGRLEKVYDAL
KDAHPKLHVYKKEAFPEAFHYANNPRVTPLLMYSDLGYVIHGRINVQFNNGEHGFDNKDM
DMKTIFRAVGPSFRAGLEVEPFESVHVYELMCRLLGIVPEANDGHLATLLPMLHTESALP
PDGRPTLLPKGRSALPPSSRPLLVMGLLGTVILLSEVA
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcccggccgtcctcctcactgtggctctggccacgctcctggctcccggggcc
ggagcaccggtacaaagtcagggctcccagaacaagctgctcctggtgtccttcgacggc
ttccgctggaactacgaccaggacgtggacacccccaacctggacgccatggcccgagac
ggggtgaaggcacgctacatgacccccgcctttgtcaccatgaccagcccctgccacttc
accctggtcaccggcaaatatatcgagaaccacggggtggttcacaacatgtactacaac
accaccagcaaggtgaagctgccctaccacgccacgctgggcatccagaggtggtgggac
aacggcagcgtgcccatctggatcacagcccagaggcagggcctgagggctggctccttc
ttctacccgggcgggaacgtcacctaccaaggggtggctgtgacgcggagccggaaagaa
ggcatcgcacacaactacaaaaatgagacggagtggagagcgaacatcgacacagtgatg
gcgtggttcacagaggaggacctggatctggtcacactctacttcggggagccggactcc
acgggccacaggtacggccccgagtccccggagaggagggagatggtgcggcaggtggac
cggaccgtgggctacctccgggagagcatcgcgcgcaaccacctcacagaccgcctcaac
ctgatcatcacatccgaccacggcatgacgaccgtggacaaacgggctggcgacctggtt
gaattccacaagttccccaacttcaccttccgggacatcgagtttgagctcctggactac
ggaccaaacgggatgctgctccctaaagaagggaggctggagaaggtgtacgatgccctc
aaggacgcccaccccaagctccacgtctacaagaaggaggcgttccccgaggccttccac
tacgccaacaaccccagggtcacacccctgctgatgtacagcgaccttggctacgtcatc
catgggagaattaacgtccagttcaacaatggggagcacggctttgacaacaaggacatg
gacatgaagaccatcttccgcgctgtgggccctagcttcagggcgggcctggaggtggag
ccctttgagagcgtccacgtgtacgagctcatgtgccggctgctgggcatcgtgcccgag
gccaacgatgggcacctagctactctgctgcccatgctgcacacagaatctgctcttccg
cctgatggaaggcctactctcctgcccaagggaagatctgctctcccgcccagcagcagg
cccctcctcgtgatgggactgctggggaccgtgattcttctgtctgaggtcgcataa

KEGG   Homo sapiens (human): 55512Help
Entry
55512             CDS       T01001                                 

Gene name
SMPD3, NSMASE2
Definition
(RefSeq) sphingomyelin phosphodiesterase 3
  KO
K12352  sphingomyelin phosphodiesterase 3 [EC:3.1.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
Network
nt06014  Sphingolipid degradation
  Element
N00649  Hydrolysis of sphingomyelin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    55512 (SMPD3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     55512 (SMPD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 55512
NCBI-ProteinID: NP_061137
OMIM: 605777
HGNC: 14240
Ensembl: ENSG00000103056
Vega: OTTHUMG00000137559
Pharos: Q9NY59(Tbio)
UniProt: Q9NY59 A8K0T6
LinkDB All DBs
Structure
PDB: 

Position
16q22.1
AA seq 655 aa AA seqDB search
MVLYTTPFPNSCLSALHCVSWALIFPCYWLVDRLAASFIPTTYEKRQRADDPCCLQLLCT
ALFTPIYLALLVASLPFAFLGFLFWSPLQSARRPYIYSRLEDKGLAGGAALLSEWKGTGP
GKSFCFATANVCLLPDSLARVNNLFNTQARAKEIGQRIRNGAARPQIKIYIDSPTNTSIS
AASFSSLVSPQGGDGVARAVPGSIKRTASVEYKGDGGRHPGDEAANGPASGDPVDSSSPE
DACIVRIGGEEGGRPPEADDPVPGGQARNGAGGGPRGQTPNHNQQDGDSGSLGSPSASRE
SLVKGRAGPDTSASGEPGANSKLLYKASVVKKAAARRRRHPDEAFDHEVSAFFPANLDFL
CLQEVFDKRAATKLKEQLHGYFEYILYDVGVYGCQGCCSFKCLNSGLLFASRYPIMDVAY
HCYPNKCNDDALASKGALFLKVQVGSTPQDQRIVGYIACTHLHAPQEDSAIRCGQLDLLQ
DWLADFRKSTSSSSAANPEELVAFDVVCGDFNFDNCSSDDKLEQQHSLFTHYRDPCRLGP
GEEKPWAIGTLLDTNGLYDEDVCTPDNLQKVLESEEGRREYLAFPTSKSSGQKGRKELLK
GNGRRIDYMLHAEEGLCPDWKAEVEEFSFITQLSGLTDHLPVAMRLMVSSGEEEA
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggttttgtacacgaccccctttcctaacagctgtctgtccgccctgcactgtgtgtcc
tgggcccttatctttccatgctactggctggtggaccggctcgctgcctccttcataccc
accacctacgagaagcgccagcgggcagacgacccgtgctgcctgcagctgctctgcact
gccctcttcacgcccatctacctggccctcctggtggcctcgctgccctttgcgtttctc
ggctttctcttctggtccccactgcagtcggcccgccggccctacatctattcacggctg
gaagacaagggcctggccggtggggcagccctgctcagtgaatggaagggcacggggcct
ggcaaaagcttctgctttgccactgccaacgtctgcctcctgcccgactcactcgccagg
gtcaacaacctttttaacacccaagcgcgggccaaggagatcgggcagagaatccgcaat
ggggccgcccggccccagatcaaaatttacatcgactcccccaccaatacctccatcagc
gccgctagcttcagcagcctggtgtcaccacagggcggcgatggggtggcccgggccgtc
cccgggagcattaagaggacagcctctgtggagtacaagggtgacggtgggcggcacccc
ggtgacgaggctgccaacggcccagcctctggggaccctgtcgacagcagcagcccggag
gatgcctgcatcgtgcgcatcggtggcgaggagggcggccggccacctgaagctgacgac
cctgtgcctgggggccaggccaggaacggagctggcgggggcccaaggggccagacgccc
aaccataatcagcaggacggggattcagggagcctgggcagcccctcggcctcccgggag
tccctggtgaaggggcgagctgggccagacaccagtgccagcggggagccaggtgccaac
agcaagctcctgtacaaggcctcggtggtgaagaaggcggctgcacgcaggaggcggcac
cccgacgaggccttcgaccatgaggtctccgccttcttccccgccaacctggacttcctg
tgcctgcaggaggtgtttgacaagcgagcagccaccaaattgaaagagcagctgcacggc
tacttcgagtacatcctgtacgacgtcggggtctacggctgccagggctgctgcagcttc
aagtgtctcaacagcggcctcctctttgccagccgctaccccatcatggacgtggcctat
cactgttaccccaacaagtgtaacgacgatgccctggcctctaagggagctctgtttctc
aaggtgcaggtgggaagcacacctcaggaccaaagaatcgtcgggtacatcgcctgcaca
cacctgcatgccccgcaagaggacagcgccatccggtgtgggcagctggacctgcttcag
gactggctggctgatttccgaaaatctacctcctcgtccagcgcagccaaccccgaggag
ctggtggcatttgacgtcgtctgtggagatttcaactttgataactgctcctctgacgac
aagctggagcagcaacactccctgttcacccactacagggacccctgccgcctggggcct
ggtgaggagaagccgtgggccatcggtactctgctggacacgaacggcctgtacgatgag
gatgtgtgcacccccgacaacctgcagaaggtcctggagagtgaggagggccgcagggag
tacctggcgtttcccaccagcaagagctcgggccagaaggggcggaaggagctgctgaag
ggcaacggccggcgcatcgactacatgctgcatgcagaggaggggctgtgcccagactgg
aaggccgaggtggaagaattcagttttatcacccagctgtccggcctgacggaccacctg
ccagtagccatgcgactgatggtgtcttcgggggaggaggaggcatag

KEGG   Homo sapiens (human): 55627Help
Entry
55627             CDS       T01001                                 

Gene name
SMPD4, NET13, NSMASE-3, NSMASE3, SKNY
Definition
(RefSeq) sphingomyelin phosphodiesterase 4
  KO
K12353  sphingomyelin phosphodiesterase 4 [EC:3.1.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
Network
nt06014  Sphingolipid degradation
  Element
N00649  Hydrolysis of sphingomyelin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    55627 (SMPD4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     55627 (SMPD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: mit_SMPDase
Motif
Other DBs
NCBI-GeneID: 55627
NCBI-ProteinID: NP_060421
OMIM: 610457
HGNC: 32949
Ensembl: ENSG00000136699
Vega: OTTHUMG00000131624
Pharos: Q9NXE4(Tbio)
UniProt: Q9NXE4
LinkDB All DBs
Position
2q21.1
AA seq 866 aa AA seqDB search
MTTFGAVAEWRLPSLRRATLWIPQWFAKKAIFNSPLEAAMAFPHLQQPSFLLASLKADSI
NKPFAQQCQDLVKVIEDFPAKELHTIFPWLVESIFGSLDGVLVGWNLRCLQGRVNPVEYS
IVMEFLDPGGPMMKLVYKLQAEDYKFDFPVSYLPGPVKASIQECILPDSPLYHNKVQFTP
TGGLGLNLALNPFEYYIFFFALSLITQKPLPVSLHVRTSDCAYFILVDRYLSWFLPTEGS
VPPPLSSSPGGTSPSPPPRTPAIPFASYGLHHTSLLKRHISHQTSVNADPASHEIWRSET
LLQVFVEMWLHHYSLEMYQKMQSPHAKLEVLHYRLSVSSALYSPAQPSLQALHAYQESFT
PTEEHVLVVRLLLKHLHAFANSLKPEQASPSAHSHATSPLEEFKRAAVPRFVQQKLYLFL
QHCFGHWPLDASFRAVLEMWLSYLQPWRYAPDKQAPGSDSQPRCVSEKWAPFVQENLLMY
TKLFVGFLNRALRTDLVSPKHALMVFRVAKVFAQPNLAEMIQKGEQLFLEPELVIPHRQH
RLFTAPTFTGSFLSPWPPAVTDASFKVKSHVYSLEGQDCKYTPMFGPEARTLVLRLAQLI
TQAKHTAKSISDQCAESPAGHSFLSWLGFSSMDTNGSYTANDLDEMGQDSVRKTDEYLEK
ALEYLRQIFRLSEAQLRQFTLALGTTQDENGKKQLPDCIVGEDGLILTPLGRYQIINGLR
RFEIEYQGDPELQPIRSYEIASLVRTLFRLSSAINHRFAGQMAALCSRDDFLGSFCRYHL
TEPGLASRHLLSPVGRRQVAGHTRGPRLSLRFLGSYRTLVSLLLAFFVASLFCVGPLPCT
LLLTLGYVLYASAMTLLTERGKLHQP
NT seq 2601 nt NT seq  +upstreamnt  +downstreamnt
atgacgactttcggcgccgtggcggaatggcggcttccatctctgaggcgagcgacgcta
tggatcccacagtggtttgctaagaaggccattttcaactctccactggaggctgctatg
gcgttccctcacctgcagcagcccagctttctactggctagcctgaaagctgactctata
aataagccctttgcacagcagtgccaagacttggttaaagtcattgaggactttccagca
aaggagctgcacaccatcttcccatggctggtagaaagcatttttggcagcctagatggt
gtcctcgttggctggaacctccgctgcttacaggggcgcgtgaatcctgtggagtacagc
atcgtgatggaatttctcgaccctggtggcccaatgatgaagttggtttataagcttcaa
gctgaagactataagttcgactttcctgtctcctacttgcctggtcctgtgaaggcgtcc
atccaggagtgcatcctccctgacagtcctctgtaccacaacaaggtccagttcacccct
actgggggccttggtctgaacttggccctgaatccgttcgagtattacatattcttcttt
gccttgagcctcatcactcagaagccacttcctgtgtccctccacgtccgtacttcagac
tgtgcctatttcatcctggtggacaggtacctgtcatggttcctgcccaccgaaggcagt
gtgcccccaccactctcctccagcccaggggggaccagcccctcaccacctcccaggaca
ccagccataccctttgcttcctatggcctccaccacactagcctcctaaagcgacacatc
tctcatcagacgtctgtgaatgcagaccccgcctcccacgagatctggaggtcagaaact
ctgctccaggtttttgttgaaatgtggcttcatcactattccttggagatgtatcaaaaa
atgcagtcccctcatgccaagctggaggttctgcactaccgactcagtgtctccagcgcc
ctctacagccccgcccaacccagcctccaggccctccacgcctaccaagagtcgttcacg
cctactgaggagcatgtgttggtggtgcgcctgctgctgaagcacctgcacgcctttgcc
aacagcctgaagccagagcaggcctcaccctccgcccactcccacgccaccagccccctg
gaggagttcaaacgggctgctgtcccgaggttcgtccagcagaaactctacctcttcttg
cagcattgctttggccactggcccctggacgcatcgttcagagctgtcctggagatgtgg
ctgagctacctgcagccgtggcggtacgcgcctgacaagcaggctccgggcagcgactcc
cagccccggtgtgtgtcggagaaatgggcaccctttgtccaggagaacctgctgatgtac
accaagttgtttgtgggctttctgaaccgcgcgctccgcacagacctggtcagccccaag
cacgcgctcatggtgttccgagtggccaaagtctttgcccagcccaacctggctgagatg
attcagaaaggtgagcagctattcctggagccagagctggtcatcccccaccgccagcac
cgactcttcacggcccccacattcactgggagcttcctgtcaccctggccaccagcggtc
actgatgcctccttcaaggtgaagagccacgtctacagcctggagggccaggactgcaag
tacaccccgatgtttgggcccgaggcccgcaccctggtcctgcgcctcgctcagctcatc
acacaggccaaacacacagccaagtccatctccgaccagtgtgcggagagcccggctggc
cactccttcctctcatggctgggctttagctccatggacaccaatggctcctacacagcc
aacgacctggacgagatggggcaagacagtgtccggaagacagatgaatacctggagaag
gccctggagtacctgcgccagatattccggctcagcgaagcgcagctcaggcagttcaca
ctcgccttgggcaccacccaggatgagaatggaaaaaagcaactccccgactgcatcgtg
ggtgaggacggactcatccttacgcccctggggcggtaccagatcatcaatgggctgcga
aggtttgaaattgagtaccagggggacccggagctgcagcccatccggagctatgagatc
gccagcttggtccgcacactctttaggctgtcgtctgccatcaaccacagatttgcagga
cagatggcggctctgtgttcccgggatgacttcctcggcagcttctgtcgctaccacctc
acagaacctgggctggccagcaggcacctgctgagccctgtggggcggaggcaggtggcc
ggccacacccgcggccccaggctcagcctgcgcttcctgggcagttaccggacgctggtc
tcgctgctgctggccttcttcgtggcctctctgttctgcgtcgggcccctcccatgcacg
ctgctgctcaccctgggctatgtcctctacgcctctgccatgacactgctgaccgagcgg
gggaagctgcaccagccctga

KEGG   Homo sapiens (human): 6609Help
Entry
6609              CDS       T01001                                 

Gene name
SMPD1, ASM, ASMASE, NPD
Definition
(RefSeq) sphingomyelin phosphodiesterase 1
  KO
K12350  sphingomyelin phosphodiesterase [EC:3.1.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
hsa04142  Lysosome
hsa04217  Necroptosis
Network
nt06014  Sphingolipid degradation
  Element
N00649  Hydrolysis of sphingomyelin
N00650  SMPD1 deficiency in sphingolipid degradation
Disease
H00137  Niemann-Pick disease type A/B
H00423  Sphingolipidosis
H00424  Defects in the degradation of sphingomyelin
Drug target
Olipudase alfa: D10820
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    6609 (SMPD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    6609 (SMPD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    6609 (SMPD1)
  09143 Cell growth and death
   04217 Necroptosis
    6609 (SMPD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     6609 (SMPD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos
Motif
Other DBs
NCBI-GeneID: 6609
NCBI-ProteinID: NP_000534
OMIM: 607608
HGNC: 11120
Ensembl: ENSG00000166311
Vega: OTTHUMG00000165453
Pharos: P17405(Tbio)
UniProt: P17405 Q59EN6
LinkDB All DBs
Structure
PDB: 

Position
11p15.4
AA seq 631 aa AA seqDB search
MPRYGASLRQSCPRSGREQGQDGTAGAPGLLWMGLVLALALALALALALSDSRVLWAPAE
AHPLSPQGHPARLHRIVPRLRDVFGWGNLTCPICKGLFTAINLGLKKEPNVARVGSVAIK
LCNLLKIAPPAVCQSIVHLFEDDMVEVWRRSVLSPSEACGLLLGSTCGHWDIFSSWNISL
PTVPKPPPKPPSPPAPGAPVSRILFLTDLHWDHDYLEGTDPDCADPLCCRRGSGLPPASR
PGAGYWGEYSKCDLPLRTLESLLSGLGPAGPFDMVYWTGDIPAHDVWHQTRQDQLRALTT
VTALVRKFLGPVPVYPAVGNHESTPVNSFPPPFIEGNHSSRWLYEAMAKAWEPWLPAEAL
RTLRIGGFYALSPYPGLRLISLNMNFCSRENFWLLINSTDPAGQLQWLVGELQAAEDRGD
KVHIIGHIPPGHCLKSWSWNYYRIVARYENTLAAQFFGHTHVDEFEVFYDEETLSRPLAV
AFLAPSATTYIGLNPGYRVYQIDGNYSGSSHVVLDHETYILNLTQANIPGAIPHWQLLYR
ARETYGLPNTLPTAWHNLVYRMRGDMQLFQTFWFLYHKGHPPSEPCGTPCRLATLCAQLS
ARADSPALCRHLMPDGSLPEAQSLWPRPLFC
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgccccgctacggagcgtcactccgccagagctgccccaggtccggccgggagcaggga
caagacgggaccgccggagcccccggactcctttggatgggcctggtgctggcgctggcg
ctggcgctggcgctggcgctggctctgtctgactctcgggttctctgggctccggcagag
gctcaccctctttctccccaaggccatcctgccaggttacatcgcatagtgccccggctc
cgagatgtctttgggtgggggaacctcacctgcccaatctgcaaaggtctattcaccgcc
atcaacctcgggctgaagaaggaacccaatgtggctcgcgtgggctccgtggccatcaag
ctgtgcaatctgctgaagatagcaccacctgccgtgtgccaatccattgtccacctcttt
gaggatgacatggtggaggtgtggagacgctcagtgctgagcccatctgaggcctgtggc
ctgctcctgggctccacctgtgggcactgggacattttctcatcttggaacatctctttg
cctactgtgccgaagccgccccccaaaccccctagccccccagccccaggtgcccctgtc
agccgcatcctcttcctcactgacctgcactgggatcatgactacctggagggcacggac
cctgactgtgcagacccactgtgctgccgccggggttctggcctgccgcccgcatcccgg
ccaggtgccggatactggggcgaatacagcaagtgtgacctgcccctgaggaccctggag
agcctgttgagtgggctgggcccagccggcccttttgatatggtgtactggacaggagac
atccccgcacatgatgtctggcaccagactcgtcaggaccaactgcgggccctgaccacc
gtcacagcacttgtgaggaagttcctggggccagtgccagtgtaccctgctgtgggtaac
catgaaagcacacctgtcaatagcttccctccccccttcattgagggcaaccactcctcc
cgctggctctatgaagcgatggccaaggcttgggagccctggctgcctgccgaagccctg
cgcaccctcagaattggggggttctatgctctttccccataccccggtctccgcctcatc
tctctcaatatgaatttttgttcccgtgagaacttctggctcttgatcaactccacggat
cccgcaggacagctccagtggctggtgggggagcttcaggctgctgaggatcgaggagac
aaagtgcatataattggccacattcccccagggcactgtctgaagagctggagctggaat
tattaccgaattgtagccaggtatgagaacaccctggctgctcagttctttggccacact
catgtggatgaatttgaggtcttctatgatgaagagactctgagccggccgctggctgta
gccttcctggcacccagtgcaactacctacatcggccttaatcctggttaccgtgtgtac
caaatagatggaaactactccgggagctctcacgtggtcctggaccatgagacctacatc
ctgaatctgacccaggcaaacataccgggagccataccgcactggcagcttctctacagg
gctcgagaaacctatgggctgcccaacacactgcctaccgcctggcacaacctggtatat
cgcatgcggggcgacatgcaacttttccagaccttctggtttctctaccataagggccac
ccaccctcggagccctgtggcacgccctgccgtctggctactctttgtgcccagctctct
gcccgtgctgacagccctgctctgtgccgccacctgatgccagatgggagcctcccagag
gcccagagcctgtggccaaggccactgttttgctag

KEGG   Homo sapiens (human): 6610Help
Entry
6610              CDS       T01001                                 

Gene name
SMPD2, ISC1, NSMASE, NSMASE1
Definition
(RefSeq) sphingomyelin phosphodiesterase 2
  KO
K12351  sphingomyelin phosphodiesterase 2 [EC:3.1.4.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa01100  Metabolic pathways
hsa04071  Sphingolipid signaling pathway
Network
nt06014  Sphingolipid degradation
  Element
N00649  Hydrolysis of sphingomyelin
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    6610 (SMPD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    6610 (SMPD2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.12  sphingomyelin phosphodiesterase
     6610 (SMPD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exo_endo_phos
Motif
Other DBs
NCBI-GeneID: 6610
NCBI-ProteinID: NP_003071
OMIM: 603498
HGNC: 11121
Ensembl: ENSG00000135587
Vega: OTTHUMG00000015348
Pharos: O60906(Tchem)
UniProt: O60906
LinkDB All DBs
Position
6q21
AA seq 423 aa AA seqDB search
MKPNFSLRLRIFNLNCWGIPYLSKHRADRMRRLGDFLNQESFDLALLEEVWSEQDFQYLR
QKLSPTYPAAHHFRSGIIGSGLCVFSKHPIQELTQHIYTLNGYPYMIHHGDWFSGKAVGL
LVLHLSGMVLNAYVTHLHAEYNRQKDIYLAHRVAQAWELAQFIHHTSKKADVVLLCGDLN
MHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYV
LYKAVSGFYISCKSFETTTGFDPHRGTPLSDHEALMATLFVRHSPPQQNPSSTHGPAERS
PLMCVLKEAWTELGLGMAQARWWATFASYVIGLGLLLLALLCVLAAGGGAGEAAILLWTP
SVGLVLWAGAFYLFHVQEVNGLYRAQAELQHVLGRAREAQDLGPEPQPALLLGQQEGDRT
KEQ
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccaacttctccctgcgactgcggatcttcaacctcaactgctggggcattccg
tacttgagcaagcaccgggccgaccgcatgaggcgcctgggagactttctgaaccaggag
agcttcgacctggctttgctggaggaggtgtggagtgagcaggacttccagtacctgaga
cagaagctgtcacctacctacccagctgcacaccacttccggagcggaatcattggcagt
ggcctctgtgtcttctccaaacatccaatccaggagcttacccagcacatctacactctc
aatggctacccctacatgatccatcatggtgactggttcagtgggaaggctgtggggctg
ctggtgctccatctaagtggcatggtgctcaacgcctatgtgacccatctccatgccgaa
tacaatcgacagaaggacatctacctagcacatcgtgtggcccaagcttgggaattggcc
cagttcatccaccacacatccaagaaggcagacgtggttctgttgtgtggagacctcaac
atgcacccagaagacctgggctgctgcctgctgaaggagtggacagggcttcatgatgcc
tatcttgaaactcgggacttcaagggctctgaggaaggcaacacaatggtacccaagaac
tgctacgtcagccagcaggagctgaagccatttccctttggtgtccgcattgactacgtg
ctttacaaggcagtttctgggttttacatctcctgtaagagttttgaaaccactacaggc
tttgaccctcacaggggcacccccctctctgatcatgaagccctgatggctactctgttt
gtgaggcacagccccccacagcagaaccccagctctacccacggaccagcagagaggtcg
ccgttgatgtgtgtgctaaaggaggcctggacggagctgggtctgggcatggctcaggct
cgctggtgggccaccttcgctagctatgtgattggcctggggctgcttctcctggcactg
ctgtgtgtcctggcggctggaggaggggccggggaagctgccatactgctctggaccccc
agtgtagggctggtgctgtgggcaggtgcattctacctcttccacgtacaggaggtcaat
ggcttatatagggcccaggctgagctccagcatgtgctaggaagggcaagggaggcccag
gatctgggcccagagcctcagccagccctactcctggggcagcaggagggggacagaact
aaagaacaataa

DBGET integrated database retrieval system