KEGG   Homo sapiens (human): 3397Help
Entry
3397              CDS       T01001                                 

Gene name
ID1, ID, bHLHb24
Definition
(RefSeq) inhibitor of DNA binding 1, HLH protein
  KO
K04680  DNA-binding protein inhibitor ID1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    3397 (ID1)
   04350 TGF-beta signaling pathway
    3397 (ID1)
   04390 Hippo signaling pathway
    3397 (ID1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3397 (ID1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3397 (ID1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    3397 (ID1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Dsl1_N
Motif
Other DBs
NCBI-GeneID: 3397
NCBI-ProteinID: NP_002156
OMIM: 600349
HGNC: 5360
Ensembl: ENSG00000125968
Vega: OTTHUMG00000032181
Pharos: P41134(Tbio)
UniProt: P41134
LinkDB All DBs
Position
20q11.21
AA seq 155 aa AA seqDB search
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcgccagtggcagcaccgccaccgccgccgcgggccccagctgcgcgctgaag
gccggcaagacagcgagcggtgcgggcgaggtggtgcgctgtctgtctgagcagagcgtg
gccatctcgcgctgcgccgggggcgccggggcgcgcctgcctgccctgctggacgagcag
caggtaaacgtgctgctctacgacatgaacggctgttactcacgcctcaaggagctggtg
cccaccctgccccagaaccgcaaggtgagcaaggtggagattctccagcacgtcatcgac
tacatcagggaccttcagttggagctgaactcggaatccgaagttggaacccccgggggc
cgagggctgccggtccgggctccgctcagcaccctcaacggcgagatcagcgccctgacg
gccgaggcggcatgcgttcctgcggacgatcgcatcttgtgtcgctga

DBGET integrated database retrieval system