KEGG   Homo sapiens (human): 339761
Entry
339761            CDS       T01001                                 

Gene name
CYP27C1
Definition
(RefSeq) cytochrome P450 family 27 subfamily C member 1
  KO
K17951  all-trans-retinol 3,4-desaturase [EC:1.14.19.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    339761 (CYP27C1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:hsa00199]
    339761 (CYP27C1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.53  all-trans-retinol 3,4-desaturase
     339761 (CYP27C1)
Cytochrome P450 [BR:hsa00199]
 Cytochrome P450, animal type
  CYP27 family
   339761 (CYP27C1)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 339761
NCBI-ProteinID: NP_001001665
HGNC: 33480
Ensembl: ENSG00000186684
Vega: OTTHUMG00000153400
Pharos: Q4G0S4(Tdark)
UniProt: Q4G0S4 A1P3N0
LinkDB
Position
2q14.3
AA seq 372 aa
MRSVLRQRILKPKDVAIYSGEVNQVIADLIKRIYLLRSQAEDGETVTNVNDLFFKYSMEG
VATILYESRLGCLENSIPQLTVEYIEALELMFSMFKTSMYAGAIPRWLRPFIPKPWREFC
RSWDGLFKFSQIHVDNKLRDIQYQMDRGRRVSGGLLTYLFLSQALTLQEIYANVTEMLLA
GVDTTSFTLSWTVYLLARHPEVQQTVYREIVKNLGERHVPTAADVPKVPLVRALLKETLR
LFPVLPGNGRVTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL
DRVDNFGSIPFGHGVRSCIGRRIAELEIHLVVIQLLQHFEIKTSSQTNAVHAKTHGLLTP
GGPIHVRFVNRK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgagaagcgtattgagacaaagaattctgaaaccgaaagatgtggccatttattctgga
gaagtcaaccaagttattgctgacttaattaaaagaatctacctcctcaggagccaggca
gaagatggagaaaccgtgaccaatgtcaatgatcttttcttcaaatattcaatggaagga
gtggccaccatcctttatgagagtcgtttgggctgcctggaaaacagcatcccacagctg
actgtggaatacatcgaggccctggagctcatgtttagcatgttcaagacctccatgtat
gcaggcgccatccccagatggcttcgccccttcatcccaaagccctggcgggaattctgc
aggtcctgggatggactcttcaaattcagccaaattcatgttgacaacaagttgagggac
atacagtaccaaatggaccgaggccggagggtgagcgggggacttctcacatacctcttc
cttagccaggctctgacgctgcaggagatctacgccaacgtgactgagatgctgctggcc
ggcgtcgacacgacgtccttcaccttgtcttggactgtgtacctcctggcaaggcaccca
gaagtgcagcagacggtgtaccgggagattgtgaagaatttaggggaaaggcatgttcca
actgcagctgatgtccccaaggtcccgctggtcagagctctccttaaggaaaccctgagg
ctgtttccagtgctgccagggaacggccgggtcacccaggaagacctggttattggcggg
tatctgattccgaaaggcacccagctggccctttgccactatgccacatcgtaccaggat
gagaacttccctcgggccaaggagttccggcctgagcgctggctgcggaaaggagactta
gatagagttgacaattttggatccatcccctttggtcatggggttcgcagctgcataggg
cggagaattgcagaactggagattcacctcgtcgtgatccagttgcttcaacattttgag
atcaaaacatcttctcagaccaatgctgttcatgcaaaaacccacgggctcctgacgcca
ggggggcccatccacgtgcgatttgttaacagaaagtaa

DBGET integrated database retrieval system