KEGG   Homo sapiens (human): 34
Entry
34                CDS       T01001                                 

Gene name
ACADM, ACAD1, MCAD, MCADH
Definition
(RefSeq) acyl-CoA dehydrogenase medium chain
  KO
K00249  acyl-CoA dehydrogenase [EC:1.3.8.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00071  Fatty acid degradation
hsa00280  Valine, leucine and isoleucine degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
Module
hsa_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
hsa_M00087  beta-Oxidation
Network
nt06020  beta-Oxidation in mitochondria
nt06024  Valine, leucine and isoleucine degradation
  Element
N00766  HADHB deficiency in beta-oxidation
N00767  HADH deficiency in beta-oxidation
N00768  ACADM deficiency in beta-oxidation
N00775  HADHA deficiency in beta-oxidation
N00804  beta-Oxidation
N00833  HMGCL deficiency in leucine degradation
N00834  AUH deficiency in leucine degradation
N00835  MCCC1 deficiency in leucine degradation
N00836  MCCC2 deficiency in leucine degradation
N00851  Leucine degradation
N00852  Valine degradation
N00853  ALDH6A1 deficiency in valine degradation
N00854  HIBCH deficiency in valine degradation
N00856  Isoleucine degradation
N00857  HSD17B10 deficiency in isoleucine degradation
Disease
H00488  MCAD deficiency
H00525  Disorders of mitochondrial fatty-acid oxidation
H01400  Secondary hyperammonemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    34 (ACADM)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    34 (ACADM)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    34 (ACADM)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.8  With a flavin as acceptor
    1.3.8.7  medium-chain acyl-CoA dehydrogenase
     34 (ACADM)
SSDB
Motif
Pfam: Acyl-CoA_dh_1 Acyl-CoA_dh_N Acyl-CoA_dh_M Acyl-CoA_dh_2 HpaB_N
Other DBs
NCBI-GeneID: 34
NCBI-ProteinID: NP_000007
OMIM: 607008
HGNC: 89
Ensembl: ENSG00000117054
Vega: OTTHUMG00000009784
Pharos: P11310(Tbio)
UniProt: P11310 A0A0S2Z366
LinkDB
Structure
PDB: 

Position
1p31.1
AA seq 421 aa
MAAGFGRCCRVLRSISRFHWRSQHTKANRQREPGLGFSFEFTEQQKEFQATARKFAREEI
IPVAAEYDKTGEYPVPLIRRAWELGLMNTHIPENCGGLGLGTFDACLISEELAYGCTGVQ
TAIEGNSLGQMPIIIAGNDQQKKKYLGRMTEEPLMCAYCVTEPGAGSDVAGIKTKAEKKG
DEYIINGQKMWITNGGKANWYFLLARSDPDPKAPANKAFTGFIVEADTPGIQIGRKELNM
GQRCSDTRGIVFEDVKVPKENVLIGDGAGFKVAMGAFDKTRPVVAAGAVGLAQRALDEAT
KYALERKTFGKLLVEHQAISFMLAEMAMKVELARMSYQRAAWEVDSGRRNTYYASIAKAF
AGDIANQLATDAVQILGGNGFNTEYPVEKLMRDAKIYQIYEGTSQIQRLIVAREHIDKYK
N
NT seq 1266 nt   +upstreamnt  +downstreamnt
atggcagcggggttcgggcgatgctgcagggtcctgagaagtatttctcgttttcattgg
agatcacagcatacaaaagccaatcgacaacgtgaaccaggattaggatttagttttgag
ttcaccgaacagcagaaagaatttcaagctactgctcgtaaatttgccagagaggaaatc
atcccagtggctgcagaatatgataaaactggtgaatatccagtccccctaattagaaga
gcctgggaacttggtttaatgaacacacacattccagagaactgtggaggtcttggactt
ggaacttttgatgcttgtttaattagtgaagaattggcttatggatgtacaggggttcag
actgctattgaaggaaattctttggggcaaatgcctattattattgctggaaatgatcaa
caaaagaagaagtatttggggagaatgactgaggagccattgatgtgtgcttattgtgta
acagaacctggagcaggctctgatgtagctggtataaagaccaaagcagaaaagaaagga
gatgagtatattattaatggtcagaagatgtggataaccaacggaggaaaagctaattgg
tattttttattggcacgttctgatccagatcctaaagctcctgctaataaagcctttact
ggattcattgtggaagcagataccccaggaattcagattgggagaaaggaattaaacatg
ggccagcgatgttcagatactagaggaattgtcttcgaagatgtgaaagtgcctaaagaa
aatgttttaattggtgacggagctggtttcaaagttgcaatgggagcttttgataaaacc
agacctgtagtagctgctggtgctgttggattagcacaaagagctttggatgaagctacc
aagtatgccctggaaaggaaaactttcggaaagctacttgtagagcaccaagcaatatca
tttatgctggctgaaatggcaatgaaagttgaactagctagaatgagttaccagagagca
gcttgggaggttgattctggtcgtcgaaatacctattatgcttctattgcaaaggcattt
gctggagatattgcaaatcagttagctactgatgctgtgcagatacttggaggcaatgga
tttaatacagaatatcctgtagaaaaactaatgagggatgccaaaatctatcagatttat
gaaggtacttcacaaattcaaagacttattgtagcccgtgaacacattgacaagtacaaa
aattaa

DBGET integrated database retrieval system