KEGG   Homo sapiens (human): 3417Help
Entry
3417              CDS       T01001                                 

Gene name
IDH1, HEL-216, HEL-S-26, IDCD, IDH, IDP, IDPC, PICD
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 1, cytosolic
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
hsa04146  Peroxisome
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Disease
H01481  Myelodysplastic syndrome (MDS)
H01892  Peripheral T cell lymphoma (PTCL)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    3417 (IDH1)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    3417 (IDH1)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    3417 (IDH1)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    3417 (IDH1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     3417 (IDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 3417
NCBI-ProteinID: NP_001269315
OMIM: 147700
HGNC: 5382
Ensembl: ENSG00000138413
Vega: OTTHUMG00000132943
Pharos: O75874(Tchem)
UniProt: O75874 V9HWJ2
LinkDB All DBs
Structure
PDB: 

Position
2q34
AA seq 414 aa AA seqDB search
MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaaaaaatcagtggcggttctgtggtagagatgcaaggagatgaaatgacacga
atcatttgggaattgattaaagagaaactcatttttccctacgtggaattggatctacat
agctatgatttaggcatagagaatcgtgatgccaccaacgaccaagtcaccaaggatgct
gcagaagctataaagaagcataatgttggcgtcaaatgtgccactatcactcctgatgag
aagagggttgaggagttcaagttgaaacaaatgtggaaatcaccaaatggcaccatacga
aatattctgggtggcacggtcttcagagaagccattatctgcaaaaatatcccccggctt
gtgagtggatgggtaaaacctatcatcataggtcgtcatgcttatggggatcaatacaga
gcaactgattttgttgttcctgggcctggaaaagtagagataacctacacaccaagtgac
ggaacccaaaaggtgacatacctggtacataactttgaagaaggtggtggtgttgccatg
gggatgtataatcaagataagtcaattgaagattttgcacacagttccttccaaatggct
ctgtctaagggttggcctttgtatctgagcaccaaaaacactattctgaagaaatatgat
gggcgttttaaagacatctttcaggagatatatgacaagcagtacaagtcccagtttgaa
gctcaaaagatctggtatgagcataggctcatcgacgacatggtggcccaagctatgaaa
tcagagggaggcttcatctgggcctgtaaaaactatgatggtgacgtgcagtcggactct
gtggcccaagggtatggctctctcggcatgatgaccagcgtgctggtttgtccagatggc
aagacagtagaagcagaggctgcccacgggactgtaacccgtcactaccgcatgtaccag
aaaggacaggagacgtccaccaatcccattgcttccatttttgcctggaccagagggtta
gcccacagagcaaagcttgataacaataaagagcttgccttctttgcaaatgctttggaa
gaagtctctattgagacaattgaggctggcttcatgaccaaggacttggctgcttgcatt
aaaggtttacccaatgtgcaacgttctgactacttgaatacatttgagttcatggataaa
cttggagaaaacttgaagatcaaactagctcaggccaaactttaa

DBGET integrated database retrieval system