KEGG   Homo sapiens (human): 3417
Entry
3417              CDS       T01001                                 

Gene name
IDH1, HEL-216, HEL-S-26, IDCD, IDH, IDP, IDPC, PICD
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 1
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
hsa04146  Peroxisome
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Network
nt06026  Glutathione biosynthesis
  Element
N00905  NADP+ reduction
Disease
H01481  Myelodysplastic syndrome
H01892  Peripheral T cell lymphoma
H02410  Myelodysplastic/myeloproliferative neoplasms
Drug target
Ivosidenib: D11090<US>
Vorasidenib (DG03113): D11834 D11835
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    3417 (IDH1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    3417 (IDH1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    3417 (IDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    3417 (IDH1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     3417 (IDH1)
SSDB
Motif
Pfam: Iso_dh
Other DBs
NCBI-GeneID: 3417
NCBI-ProteinID: NP_001269315
OMIM: 147700
HGNC: 5382
Ensembl: ENSG00000138413
Vega: OTTHUMG00000132943
Pharos: O75874(Tchem)
UniProt: O75874 A0A024R3Y6
LinkDB
Structure
PDB: 

Position
2q34
AA seq 414 aa
MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDATNDQVTKDA
AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRL
VSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAM
GMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQFE
AQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDG
KTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALE
EVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL
NT seq 1245 nt   +upstreamnt  +downstreamnt
atgtccaaaaaaatcagtggcggttctgtggtagagatgcaaggagatgaaatgacacga
atcatttgggaattgattaaagagaaactcatttttccctacgtggaattggatctacat
agctatgatttaggcatagagaatcgtgatgccaccaacgaccaagtcaccaaggatgct
gcagaagctataaagaagcataatgttggcgtcaaatgtgccactatcactcctgatgag
aagagggttgaggagttcaagttgaaacaaatgtggaaatcaccaaatggcaccatacga
aatattctgggtggcacggtcttcagagaagccattatctgcaaaaatatcccccggctt
gtgagtggatgggtaaaacctatcatcataggtcgtcatgcttatggggatcaatacaga
gcaactgattttgttgttcctgggcctggaaaagtagagataacctacacaccaagtgac
ggaacccaaaaggtgacatacctggtacataactttgaagaaggtggtggtgttgccatg
gggatgtataatcaagataagtcaattgaagattttgcacacagttccttccaaatggct
ctgtctaagggttggcctttgtatctgagcaccaaaaacactattctgaagaaatatgat
gggcgttttaaagacatctttcaggagatatatgacaagcagtacaagtcccagtttgaa
gctcaaaagatctggtatgagcataggctcatcgacgacatggtggcccaagctatgaaa
tcagagggaggcttcatctgggcctgtaaaaactatgatggtgacgtgcagtcggactct
gtggcccaagggtatggctctctcggcatgatgaccagcgtgctggtttgtccagatggc
aagacagtagaagcagaggctgcccacgggactgtaacccgtcactaccgcatgtaccag
aaaggacaggagacgtccaccaatcccattgcttccatttttgcctggaccagagggtta
gcccacagagcaaagcttgataacaataaagagcttgccttctttgcaaatgctttggaa
gaagtctctattgagacaattgaggctggcttcatgaccaaggacttggctgcttgcatt
aaaggtttacccaatgtgcaacgttctgactacttgaatacatttgagttcatggataaa
cttggagaaaacttgaagatcaaactagctcaggccaaactttaa

KEGG   Homo sapiens (human): 3418
Entry
3418              CDS       T01001                                 

Gene name
IDH2, D2HGA2, ICD-M, IDH, IDHM, IDP, IDPM, mNADP-IDH
Definition
(RefSeq) isocitrate dehydrogenase (NADP(+)) 2
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00020  Citrate cycle (TCA cycle)
hsa00480  Glutathione metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
hsa04146  Peroxisome
hsa05230  Central carbon metabolism in cancer
Module
hsa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
hsa_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Network
nt06026  Glutathione biosynthesis
  Element
N00905  NADP+ reduction
Disease
H01225  D-2-hydroxyglutaric aciduria
H01481  Myelodysplastic syndrome
H01892  Peripheral T cell lymphoma
H02410  Myelodysplastic/myeloproliferative neoplasms
H02412  Atypical chronic myeloid leukemia
Drug target
Enasidenib (DG02837): D10901 D11044<US>
Vorasidenib (DG03113): D11834 D11835
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    3418 (IDH2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    3418 (IDH2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    3418 (IDH2)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    3418 (IDH2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     3418 (IDH2)
SSDB
Motif
Pfam: Iso_dh Phe_ZIP
Other DBs
NCBI-GeneID: 3418
NCBI-ProteinID: NP_002159
OMIM: 147650
HGNC: 5383
Ensembl: ENSG00000182054
Vega: OTTHUMG00000149815
Pharos: P48735(Tbio)
UniProt: P48735
LinkDB
Structure
PDB: 

Position
15q26.1
AA seq 452 aa
MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTR
IIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDE
ARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYK
ATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAI
QKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKS
SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQK
GRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ
NT seq 1359 nt   +upstreamnt  +downstreamnt
atggccggctacctgcgggtcgtgcgctcgctctgcagagcctcaggctcgcggccggcc
tgggcgccggcggccctgacagcccccacctcgcaagagcagccgcggcgccactatgcc
gacaaaaggatcaaggtggcgaagcccgtggtggagatggatggtgatgagatgacccgt
attatctggcagttcatcaaggagaagctcatcctgccccacgtggacatccagctaaag
tattttgacctcgggctcccaaaccgtgaccagactgatgaccaggtcaccattgactct
gcactggccacccagaagtacagtgtggctgtcaagtgtgccaccatcacccctgatgag
gcccgtgtggaagagttcaagctgaagaagatgtggaaaagtcccaatggaactatccgg
aacatcctgggggggactgtcttccgggagcccatcatctgcaaaaacatcccacgccta
gtccctggctggaccaagcccatcaccattggcaggcacgcccatggcgaccagtacaag
gccacagactttgtggcagaccgggccggcactttcaaaatggtcttcaccccaaaagat
ggcagtggtgtcaaggagtgggaagtgtacaacttccccgcaggcggcgtgggcatgggc
atgtacaacaccgacgagtccatctcaggttttgcgcacagctgcttccagtatgccatc
cagaagaaatggccgctgtacatgagcaccaagaacaccatactgaaagcctacgatggg
cgtttcaaggacatcttccaggagatctttgacaagcactataagaccgacttcgacaag
aataagatctggtatgagcaccggctcattgatgacatggtggctcaggtcctcaagtct
tcgggtggctttgtgtgggcctgcaagaactatgacggagatgtgcagtcagacatcctg
gcccagggctttggctcccttggcctgatgacgtccgtcctggtctgccctgatgggaag
acgattgaggctgaggccgctcatgggaccgtcacccgccactatcgggagcaccagaag
ggccggcccaccagcaccaaccccatcgccagcatctttgcctggacacgtggcctggag
caccgggggaagctggatgggaaccaagacctcatcaggtttgcccagatgctggagaag
gtgtgcgtggagacggtggagagtggagccatgaccaaggacctggcgggctgcattcac
ggcctcagcaatgtgaagctgaacgagcacttcctgaacaccacggacttcctcgacacc
atcaagagcaacctggacagagccctgggcaggcagtag

DBGET integrated database retrieval system