KEGG   Homo sapiens (human): 3423Help
Entry
3423              CDS       T01001                                 

Gene name
IDS, ID2S, MPS2, SIDS
Definition
(RefSeq) iduronate 2-sulfatase
  KO
K01136  iduronate 2-sulfatase [EC:3.1.6.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00078  Heparan sulfate degradation
Network
nt06012  Glycosaminoglycan degradation
  Element
N00610  Dermatan sulfate degradation
N00611  HYAL1 deficiency in dermatan sulfate degradation
N00612  ARSB deficiency in dermatan sulfate degradation
N00613  IDUA deficiency in dermatan sulfate degradation
N00614  IDS deficiency in dermatan sulfate degradation
N00615  Heparan sulfate degradation
N00616  GNS deficiency in heparan sulfate degradation
N00617  GUSB deficiency in heparan sulfate degradation
N00618  NAGLU deficiency in heparan sulfate degradation
N00619  HGSNAT deficiency in heparan sulfate degradation
N00620  SGSH deficiency in heparan sulfate degradation
N00621  IDUA deficiency in heparan sulfate degradation
N00622  IDS deficiency in heparan sulfate degradation
N10013  Replacement of deficient IDS
Disease
H00129  Mucopolysaccharidosis type II
H00421  Mucopolysaccharidosis
Drug target
Idursulfase: D04499
Idursulfase beta: D11025
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    3423 (IDS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    3423 (IDS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.13  iduronate-2-sulfatase
     3423 (IDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfatase Phosphodiest DUF229
Motif
Other DBs
NCBI-GeneID: 3423
NCBI-ProteinID: NP_000193
OMIM: 300823
HGNC: 5389
Ensembl: ENSG00000010404
Vega: OTTHUMG00000022615
Pharos: P22304(Tbio)
UniProt: P22304
LinkDB All DBs
Structure
PDB: 

Position
Xq28
AA seq 550 aa AA seqDB search
MPPPRTGRGLLWLGLVLSSVCVALGSETQANSTTDALNVLLIIVDDLRPSLGCYGDKLVR
SPNIDQLASHSLLFQNAFAQQAVCAPSRVSFLTGRRPDTTRLYDFNSYWRVHAGNFSTIP
QYFKENGYVTMSVGKVFHPGISSNHTDDSPYSWSFPPYHPSSEKYENTKTCRGPDGELHA
NLLCPVDVLDVPEGTLPDKQSTEQAIQLLEKMKTSASPFFLAVGYHKPHIPFRYPKEFQK
LYPLENITLAPDPEVPDGLPPVAYNPWMDIRQREDVQALNISVPYGPIPVDFQRKIRQSY
FASVSYLDTQVGRLLSALDDLQLANSTIIAFTSDHGWALGEHGEWAKYSNFDVATHVPLI
FYVPGRTASLPEAGEKLFPYLDPFDSASQLMEPGRQSMDLVELVSLFPTLAGLAGLQVPP
RCPVPSFHVELCREGKNLLKHFRFRDLEEDPYLPGNPRELIAYSQYPRPSDIPQWNSDKP
SLKDIKIMGYSIRTIDYRYTVWVGFNPDEFLANFSDIHAGELYFVDSDPLQDHNMYNDSQ
GGDLFQLLMP
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgccgccaccccggaccggccgaggccttctctggctgggtctggttctgagctccgtc
tgcgtcgccctcggatccgaaacgcaggccaactcgaccacagatgctctgaacgttctt
ctcatcatcgtggatgacctgcgcccctccctgggctgttatggggataagctggtgagg
tccccaaatattgaccaactggcatcccacagcctcctcttccagaatgcctttgcgcag
caagcagtgtgcgccccgagccgcgtttctttcctcactggcaggagacctgacaccacc
cgcctgtacgacttcaactcctactggagggtgcacgctggaaacttctccaccatcccc
cagtacttcaaggagaatggctatgtgaccatgtcggtgggaaaagtctttcaccctggg
atatcttctaaccataccgatgattctccgtatagctggtcttttccaccttatcatcct
tcctctgagaagtatgaaaacactaagacatgtcgagggccagatggagaactccatgcc
aacctgctttgccctgtggatgtgctggatgttcccgagggcaccttgcctgacaaacag
agcactgagcaagccatacagttgttggaaaagatgaaaacgtcagccagtcctttcttc
ctggccgttgggtatcataagccacacatccccttcagataccccaaggaatttcagaag
ttgtatcccttggagaacatcaccctggcccccgatcccgaggtccctgatggcctaccc
cctgtggcctacaacccctggatggacatcaggcaacgggaagacgtccaagccttaaac
atcagtgtgccgtatggtccaattcctgtggactttcagcggaaaatccgccagagctac
tttgcctctgtgtcatatttggatacacaggtcggccgcctcttgagtgctttggacgat
cttcagctggccaacagcaccatcattgcatttacctcggatcatgggtgggctctaggt
gaacatggagaatgggccaaatacagcaattttgatgttgctacccatgttcccctgata
ttctatgttcctggaaggacggcttcacttccggaggcaggcgagaagcttttcccttac
ctcgacccttttgattccgcctcacagttgatggagccaggcaggcaatccatggacctt
gtggaacttgtgtctctttttcccacgctggctggacttgcaggactgcaggttccacct
cgctgccccgttccttcatttcacgttgagctgtgcagagaaggcaagaaccttctgaag
cattttcgattccgtgacttggaagaggatccgtacctccctggtaatccccgtgaactg
attgcctatagccagtatccccggccttcagacatccctcagtggaattctgacaagccg
agtttaaaagatataaagatcatgggctattccatacgcaccatagactataggtatact
gtgtgggttggcttcaatcctgatgaatttctagctaacttttctgacatccatgcaggg
gaactgtattttgtggattctgacccattgcaggatcacaatatgtataatgattcccaa
ggtggagatcttttccagttgttgatgccttga

DBGET integrated database retrieval system