KEGG   Homo sapiens (human): 343472Help
Entry
343472            CDS       T01001                                 

Gene name
BARHL2
Definition
(RefSeq) BarH like homeobox 2
  KO
K09360  BarH-like
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    343472 (BARHL2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, not assigned
    343472 (BARHL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain
Motif
Other DBs
NCBI-GeneID: 343472
NCBI-ProteinID: NP_064447
OMIM: 605212
HGNC: 954
Ensembl: ENSG00000143032
Vega: OTTHUMG00000010020
Pharos: Q9NY43(Tdark)
UniProt: Q9NY43
LinkDB All DBs
Position
1p22.2
AA seq 387 aa AA seqDB search
MTMEGASGSSFGIDTILSSASSGSPGMMNGDFRPLGEARTADFRSQATPSPCSEIDTVGT
APSSPISVTMEPPEPHLVADATQHHHHLHHSQQPPPPAAAPTQSLQPLPQQQQPLPPQQP
PPPPPQQLGSAASAPRTSTSSFLIKDILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHE
SFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRKARTAFS
DHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTKWKRQTAVGLELLAE
AGNYSALQRMFPSPYFYHPSLLGSMDSTTAAAAAAAMYSSMYRTPPAPHPQLQRPLVPRV
LIHGLGPGGQPALNPLSSPIPGTPHPR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggaaggggccagcgggtcgagttttggaatagacacgattttgtccagtgcc
agttcaggcagcccaggcatgatgaatggagatttccgcccgctcggtgaggccaggacc
gcggattttaggagtcaggccaccccatctccctgttcggagattgataccgtagggacg
gcgccttcttctcctatctcagtcaccatggagcccccggagccgcatctggtagcagac
gcgacccagcatcatcaccacctccaccacagccagcagccgccgccgccggccgcggcc
ccgacgcaaagtttgcagcctttgccccaacagcagcagccgctgccgccacagcagccg
ccgccgccgcccccccagcagctgggctcggccgcctcggcccccaggacttccacgtct
tcttttttaattaaggacatcttgggcgacagcaaacctctggcggcatgtgcaccctac
agcaccagcgtatcctctccccaccacaccccgaagcaggagagcaacgcagtgcacgag
agcttcaggccaaagctcgagcaggaggacagcaagaccaaactcgacaagcgggaggat
tcccagagcgacatcaaatgccacgggacaaaggaggaaggagaccgggagattacgagt
agccgtgagagtccccctgtgagagccaagaagcctcgaaaagcaaggacagctttttcc
gaccaccagctcaatcaactggagcgtagctttgagcggcagaagtacctgagcgtgcag
gatcgcatggacctggctgcagcgctcaacctcactgacacccaagtcaagacctggtac
cagaaccgcaggaccaagtggaagcggcagacagcggtgggcctggagttgctggccgag
gcagggaactactcggcgctgcagaggatgtttccatcgccttatttctatcacccaagc
ctgctgggcagcatggacagcactacggcggcggcggctgccgctgccatgtacagcagc
atgtaccggactcctccagcaccccatccccagctgcagcggcccctggtgccccgtgtg
ctcatccacggcctagggcctgggggacagccagcccttaatccattgtccagccccatc
ccaggcaccccacacccccggtga

DBGET integrated database retrieval system