KEGG   Homo sapiens (human): 343641Help
Entry
343641            CDS       T01001                                 

Gene name
TGM6, SCA35, TG6, TGM3L, TGY, dJ734P14.3
Definition
(RefSeq) transglutaminase 6
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
hsa  Homo sapiens (human)
Disease
H00063  Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    343641 (TGM6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     343641 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 343641
NCBI-ProteinID: NP_945345
OMIM: 613900
HGNC: 16255
Ensembl: ENSG00000166948
Vega: OTTHUMG00000031692
Pharos: O95932(Tchem)
UniProt: O95932
LinkDB All DBs
Position
20p13
AA seq 706 aa AA seqDB search
MAGIRVTKVDWQRSRNGAAHHTQEYPCPELVVRRGQSFSLTLELSRALDCEEILIFTMET
GPRASEALHTKAVFQTSELERGEGWTAAREAQMEKTLTVSLASPPSAVIGRYLLSIRLSS
HRKHSNRRLGEFVLLFNPWCAEDDVFLASEEERQEYVLSDSGIIFRGVEKHIRAQGWNYG
QFEEDILNICLSILDRSPGHQNNPATDVSCRHNPIYVTRVISAMVNSNNDRGVVQGQWQG
KYGGGTSPLHWRGSVAILQKWLKGRYKPVKYGQCWVFAGVLCTVLRCLGIATRVVSNFNS
AHDTDQNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQ
EESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDESRERVYSNTKKI
GRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVNRLFGVEASGRRIWIRRAGGRC
LWRDDLLEPATKPSIAGKFKVLEPPMLGHDLRLALCLANLTSRAQRVRVNLSGATILYTR
KPVAEILHESHAVRLGPQEEKRIPITISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEK
DITLEDFITIKVLGPAMVGVAVTVEVTVVNPLIERVKDCALMVEGSGLLQEQLSIDVPTL
EPQERASVQFDITPSKSGPRQLQVDLVSPHFPDIKGFVIVHVATAK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcagggatcagagtcaccaaggtggactggcagcggtcgaggaatggcgctgcccac
cacacccaggagtacccctgccctgagctggtggttcgcaggggccagtcgttcagcctc
acgctggagctgagcagagccctggactgtgaggagatcctcatcttcacgatggagaca
ggaccccgggcttctgaggccctccacaccaaagctgtgttccagacatcggagctggag
cggggtgagggctggacagcagcaagggaggctcagatggagaaaactctgaccgtcagt
ctcgccagccctcccagtgctgtcattggccgctacctgctgagcatcaggctttcctct
caccgcaaacacagcaaccggaggctgggcgagtttgttctccttttcaacccatggtgt
gcagaggacgatgtgtttctggcctcagaggaggagagacaggagtacgtgctcagcgac
agcggcatcatcttccgaggcgtggagaagcacatacgagcccagggctggaactacggg
cagtttgaggaggacatcctgaacatctgcctctccatcctggatcgaagccccggtcac
caaaacaacccagccaccgacgtgtcctgccgccacaaccccatctacgtcaccagggtc
atcagtgccatggtgaacagcaacaacgaccgaggtgtggtgcaaggacagtggcagggc
aagtacggcggcggcaccagcccgctgcactggcgcggcagcgtggccattctgcagaag
tggctcaagggcaggtacaagccagtcaagtacggccagtgctgggtcttcgccggagtc
ctgtgcacagtcctcaggtgcttggggatagccacacgggtcgtgtccaacttcaactca
gcccacgacacagaccagaacctgagtgtggacaaatacgtggactccttcgggcggacc
ctggaggacctgacagaagacagcatgtggaatttccatgtctggaatgagagctggttt
gcccggcaggacctaggcccctcttacaatggctggcaggttctggatgccaccccccag
gaggagagtgaaggtgtgttccggtgcggcccagcctcagtcaccgccatccgcgagggt
gatgtgcacctggctcacgatggccccttcgtgtttgcggaggtcaacgccgactacatc
acctggctgtggcacgaggatgagagccgggagcgtgtatactcaaacacgaagaagatt
gggagatgcatcagcaccaaggcggtgggcagtgactcccgcgtggacatcactgacctc
tacaagtatccggaagggtcccggaaagagaggcaggtgtacagcaaggcggtgaacagg
ctgttcggcgtggaagcctctggaaggagaatctggatccgcagggctgggggtcgctgt
ctctggcgtgacgacctcctggagcctgccaccaagcccagcatcgctggcaagttcaag
gtgctagagcctcccatgctgggccacgacctgagactggccctgtgcttggccaacctc
acctcccgggcccagcgggtgagggtcaacctgagcggtgccaccatcctctatacccgc
aagccagtggcagagatcctgcatgaatcccacgccgtgaggctggggccgcaagaagag
aagagaatcccaattacaatatcttactctaagtataaagaagacctgacagaggacaag
aagatcctgttggctgccatgtgccttgtcaccaaaggagagaagcttctggtggagaag
gacattactctagaggacttcatcaccatcaaggttctgggcccagccatggtgggagtg
gcagttacagtggaagtgacagtagtcaaccccctcatagagagagtgaaggactgtgcg
ctgatggtggagggcagcggccttctccaggaacagctcagcatcgacgtgcctaccctg
gagcctcaggagagggcctcagtccagtttgacatcaccccctccaaaagtggcccaagg
cagctgcaggtggaccttgtaagccctcacttcccggacatcaagggctttgtgatcgtc
catgtggccactgccaagtga

DBGET integrated database retrieval system