KEGG   Homo sapiens (human): 3439
Entry
3439              CDS       T01001                                 

Gene name
IFNA1, IFL, IFN, IFN-ALPHA, IFN-alphaD, IFNA13, IFNA@, leIF_D
Definition
(RefSeq) interferon alpha 1
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06119  JAK-STAT signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06219  JAK-STAT signaling
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3439 (IFNA1)
   04151 PI3K-Akt signaling pathway
    3439 (IFNA1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3439 (IFNA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3439 (IFNA1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3439 (IFNA1)
   04621 NOD-like receptor signaling pathway
    3439 (IFNA1)
   04622 RIG-I-like receptor signaling pathway
    3439 (IFNA1)
   04623 Cytosolic DNA-sensing pathway
    3439 (IFNA1)
   04650 Natural killer cell mediated cytotoxicity
    3439 (IFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3439 (IFNA1)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3439 (IFNA1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3439 (IFNA1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3439 (IFNA1)
   05161 Hepatitis B
    3439 (IFNA1)
   05160 Hepatitis C
    3439 (IFNA1)
   05171 Coronavirus disease - COVID-19
    3439 (IFNA1)
   05164 Influenza A
    3439 (IFNA1)
   05162 Measles
    3439 (IFNA1)
   05168 Herpes simplex virus 1 infection
    3439 (IFNA1)
   05163 Human cytomegalovirus infection
    3439 (IFNA1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3439 (IFNA1)
   05169 Epstein-Barr virus infection
    3439 (IFNA1)
   05165 Human papillomavirus infection
    3439 (IFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3439 (IFNA1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3439 (IFNA1)
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 3439
NCBI-ProteinID: NP_076918
OMIM: 147660
HGNC: 5417
Ensembl: ENSG00000197919
Vega: OTTHUMG00000019673
Pharos: P01562(Tbio)
UniProt: P01562 L0N195
LinkDB
Structure
PDB: 
3UX9

Position
9p21.3
AA seq 189 aa
MASPFALLMVLVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFG
FPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLE
ACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcctcgccctttgctttactgatggtcctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtgatctccctgagacccacagcctggataacaggaggaccttgatgctc
ctggcacaaatgagcagaatctctccttcctcctgtctgatggacagacatgactttgga
tttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtcctc
catgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgcttgg
gatgaggacctcctagacaaattctgcaccgaactctaccagcagctgaatgacttggaa
gcctgtgtgatgcaggaggagagggtgggagaaactcccctgatgaatgcggactccatc
ttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttatcaacaaac
ttgcaagaaagattaaggaggaaggaataa

KEGG   Homo sapiens (human): 3440
Entry
3440              CDS       T01001                                 

Gene name
IFNA2, IFN-alpha-2, IFN-alphaA, IFNA, IFNA2B, leIF_A
Definition
(RefSeq) interferon alpha 2
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3440 (IFNA2)
   04151 PI3K-Akt signaling pathway
    3440 (IFNA2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3440 (IFNA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3440 (IFNA2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3440 (IFNA2)
   04621 NOD-like receptor signaling pathway
    3440 (IFNA2)
   04622 RIG-I-like receptor signaling pathway
    3440 (IFNA2)
   04623 Cytosolic DNA-sensing pathway
    3440 (IFNA2)
   04650 Natural killer cell mediated cytotoxicity
    3440 (IFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3440 (IFNA2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3440 (IFNA2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3440 (IFNA2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3440 (IFNA2)
   05161 Hepatitis B
    3440 (IFNA2)
   05160 Hepatitis C
    3440 (IFNA2)
   05171 Coronavirus disease - COVID-19
    3440 (IFNA2)
   05164 Influenza A
    3440 (IFNA2)
   05162 Measles
    3440 (IFNA2)
   05168 Herpes simplex virus 1 infection
    3440 (IFNA2)
   05163 Human cytomegalovirus infection
    3440 (IFNA2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3440 (IFNA2)
   05169 Epstein-Barr virus infection
    3440 (IFNA2)
   05165 Human papillomavirus infection
    3440 (IFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3440 (IFNA2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3440 (IFNA2)
SSDB
Motif
Pfam: Interferon CBF APC1_C DDHD
Other DBs
NCBI-GeneID: 3440
NCBI-ProteinID: NP_000596
OMIM: 147562
HGNC: 5423
Ensembl: ENSG00000188379
Vega: OTTHUMG00000019674
Pharos: P01563(Tbio)
UniProt: P01563
LinkDB
Structure
PDB: 

Position
9p21.3
AA seq 188 aa
MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFG
FPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEA
CVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNL
QESLRSKE
NT seq 567 nt   +upstreamnt  +downstreamnt
atggccttgacctttgctttactggtggccctcctggtgctcagctgcaagtcaagctgc
tctgtgggctgtgatctgcctcaaacccacagcctgggtagcaggaggaccttgatgctc
ctggcacagatgaggagaatctctcttttctcctgcttgaaggacagacatgactttgga
tttccccaggaggagtttggcaaccagttccaaaaggctgaaaccatccctgtcctccat
gagatgatccagcagatcttcaatctcttcagcacaaaggactcatctgctgcttgggat
gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagcc
tgtgtgatacagggggtgggggtgacagagactcccctgatgaaggaggactccattctg
gctgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagccct
tgtgcctgggaggttgtcagagcagaaatcatgagatctttttctttgtcaacaaacttg
caagaaagtttaagaagtaaggaatga

KEGG   Homo sapiens (human): 3441
Entry
3441              CDS       T01001                                 

Gene name
IFNA4, IFN-alpha4a, INFA4
Definition
(RefSeq) interferon alpha 4
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3441 (IFNA4)
   04151 PI3K-Akt signaling pathway
    3441 (IFNA4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3441 (IFNA4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3441 (IFNA4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3441 (IFNA4)
   04621 NOD-like receptor signaling pathway
    3441 (IFNA4)
   04622 RIG-I-like receptor signaling pathway
    3441 (IFNA4)
   04623 Cytosolic DNA-sensing pathway
    3441 (IFNA4)
   04650 Natural killer cell mediated cytotoxicity
    3441 (IFNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3441 (IFNA4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3441 (IFNA4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3441 (IFNA4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3441 (IFNA4)
   05161 Hepatitis B
    3441 (IFNA4)
   05160 Hepatitis C
    3441 (IFNA4)
   05171 Coronavirus disease - COVID-19
    3441 (IFNA4)
   05164 Influenza A
    3441 (IFNA4)
   05162 Measles
    3441 (IFNA4)
   05168 Herpes simplex virus 1 infection
    3441 (IFNA4)
   05163 Human cytomegalovirus infection
    3441 (IFNA4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3441 (IFNA4)
   05169 Epstein-Barr virus infection
    3441 (IFNA4)
   05165 Human papillomavirus infection
    3441 (IFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3441 (IFNA4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3441 (IFNA4)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 3441
NCBI-ProteinID: NP_066546
OMIM: 147564
HGNC: 5425
Ensembl: ENSG00000236637
Vega: OTTHUMG00000019660
Pharos: P05014(Tbio)
UniProt: P05014
LinkDB
Position
9p21.3
AA seq 189 aa
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFG
FPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcatttctcctgcctgaaggacagacatgatttcgga
ttccccgaggaggagtttgatggccaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctcgttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Homo sapiens (human): 3442
Entry
3442              CDS       T01001                                 

Gene name
IFNA5, IFN-alpha-5, IFN-alphaG, INA5, INFA5, leIF_G
Definition
(RefSeq) interferon alpha 5
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3442 (IFNA5)
   04151 PI3K-Akt signaling pathway
    3442 (IFNA5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3442 (IFNA5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3442 (IFNA5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3442 (IFNA5)
   04621 NOD-like receptor signaling pathway
    3442 (IFNA5)
   04622 RIG-I-like receptor signaling pathway
    3442 (IFNA5)
   04623 Cytosolic DNA-sensing pathway
    3442 (IFNA5)
   04650 Natural killer cell mediated cytotoxicity
    3442 (IFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3442 (IFNA5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3442 (IFNA5)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3442 (IFNA5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3442 (IFNA5)
   05161 Hepatitis B
    3442 (IFNA5)
   05160 Hepatitis C
    3442 (IFNA5)
   05171 Coronavirus disease - COVID-19
    3442 (IFNA5)
   05164 Influenza A
    3442 (IFNA5)
   05162 Measles
    3442 (IFNA5)
   05168 Herpes simplex virus 1 infection
    3442 (IFNA5)
   05163 Human cytomegalovirus infection
    3442 (IFNA5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3442 (IFNA5)
   05169 Epstein-Barr virus infection
    3442 (IFNA5)
   05165 Human papillomavirus infection
    3442 (IFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3442 (IFNA5)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3442 (IFNA5)
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 3442
NCBI-ProteinID: NP_002160
OMIM: 147565
HGNC: 5426
Ensembl: ENSG00000147873
Vega: OTTHUMG00000019664
Pharos: P01569(Tbio)
UniProt: P01569
LinkDB
Position
9p21.3
AA seq 189 aa
MALPFVLLMALVVLNCKSICSLGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLE
ACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSAN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgccctttgttttactgatggccctggtggtgctcaactgcaagtcaatctgt
tctctgggctgtgatctgcctcagacccacagcctgagtaacaggaggactttgatgata
atggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
tttcctcaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctacttgg
gatgagacacttctagacaaattctacactgaactttaccagcagctgaatgacctggaa
gcctgtatgatgcaggaggttggagtggaagacactcctctgatgaatgtggactctatc
ctgactgtgagaaaatactttcaaagaatcaccctctatctgacagagaagaaatacagc
ccttgtgcatgggaggttgtcagagcagaaatcatgagatccttctctttatcagcaaac
ttgcaagaaagattaaggaggaaggaatga

KEGG   Homo sapiens (human): 3443
Entry
3443              CDS       T01001                                 

Gene name
IFNA6, IFN-alphaK
Definition
(RefSeq) interferon alpha 6
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3443 (IFNA6)
   04151 PI3K-Akt signaling pathway
    3443 (IFNA6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3443 (IFNA6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3443 (IFNA6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3443 (IFNA6)
   04621 NOD-like receptor signaling pathway
    3443 (IFNA6)
   04622 RIG-I-like receptor signaling pathway
    3443 (IFNA6)
   04623 Cytosolic DNA-sensing pathway
    3443 (IFNA6)
   04650 Natural killer cell mediated cytotoxicity
    3443 (IFNA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3443 (IFNA6)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3443 (IFNA6)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3443 (IFNA6)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3443 (IFNA6)
   05161 Hepatitis B
    3443 (IFNA6)
   05160 Hepatitis C
    3443 (IFNA6)
   05171 Coronavirus disease - COVID-19
    3443 (IFNA6)
   05164 Influenza A
    3443 (IFNA6)
   05162 Measles
    3443 (IFNA6)
   05168 Herpes simplex virus 1 infection
    3443 (IFNA6)
   05163 Human cytomegalovirus infection
    3443 (IFNA6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3443 (IFNA6)
   05169 Epstein-Barr virus infection
    3443 (IFNA6)
   05165 Human papillomavirus infection
    3443 (IFNA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3443 (IFNA6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3443 (IFNA6)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 3443
NCBI-ProteinID: NP_066282
OMIM: 147566
HGNC: 5427
Ensembl: ENSG00000120235
Vega: OTTHUMG00000019676
Pharos: P05013(Tbio)
UniProt: P05013
LinkDB
Position
9p21.3
AA seq 189 aa
MALPFALLMALVVLSCKSSCSLDCDLPQTHSLGHRRTMMLLAQMRRISLFSCLKDRHDFR
FPQEEFDGNQFQKAEAISVLHEVIQQTFNLFSTKDSSVAWDERLLDKLYTELYQQLNDLE
ACVMQEVWVGGTPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSSSRN
LQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggctttgccttttgctttactgatggccctggtggtgctcagctgcaagtcaagctgc
tctctggactgtgatctgcctcagacccacagcctgggtcacaggaggaccatgatgctc
ctggcacaaatgaggagaatctctcttttctcctgtctgaaggacagacatgacttcaga
tttccccaggaggagtttgatggcaaccagttccagaaggctgaagccatctctgtcctc
catgaggtgattcagcagaccttcaacctcttcagcacaaaggactcatctgttgcttgg
gatgagaggcttctagacaaactctatactgaactttaccagcagctgaatgacctggaa
gcctgtgtgatgcaggaggtgtgggtgggagggactcccctgatgaatgaggactccatc
ctggctgtgagaaaatacttccaaagaatcactctctacctgacagagaaaaagtacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctcttcatcaagaaac
ttgcaagaaaggttaaggaggaaggaataa

KEGG   Homo sapiens (human): 3444
Entry
3444              CDS       T01001                                 

Gene name
IFNA7, IFN-alphaJ, IFNA-J
Definition
(RefSeq) interferon alpha 7
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3444 (IFNA7)
   04151 PI3K-Akt signaling pathway
    3444 (IFNA7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3444 (IFNA7)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3444 (IFNA7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3444 (IFNA7)
   04621 NOD-like receptor signaling pathway
    3444 (IFNA7)
   04622 RIG-I-like receptor signaling pathway
    3444 (IFNA7)
   04623 Cytosolic DNA-sensing pathway
    3444 (IFNA7)
   04650 Natural killer cell mediated cytotoxicity
    3444 (IFNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3444 (IFNA7)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3444 (IFNA7)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3444 (IFNA7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3444 (IFNA7)
   05161 Hepatitis B
    3444 (IFNA7)
   05160 Hepatitis C
    3444 (IFNA7)
   05171 Coronavirus disease - COVID-19
    3444 (IFNA7)
   05164 Influenza A
    3444 (IFNA7)
   05162 Measles
    3444 (IFNA7)
   05168 Herpes simplex virus 1 infection
    3444 (IFNA7)
   05163 Human cytomegalovirus infection
    3444 (IFNA7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3444 (IFNA7)
   05169 Epstein-Barr virus infection
    3444 (IFNA7)
   05165 Human papillomavirus infection
    3444 (IFNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3444 (IFNA7)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3444 (IFNA7)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 3444
NCBI-ProteinID: NP_066401
OMIM: 147567
HGNC: 5428
Ensembl: ENSG00000214042
Vega: OTTHUMG00000019662
Pharos: P01567(Tdark)
UniProt: P01567
LinkDB
Position
9p21.3
AA seq 189 aa
MARSFSLLMVVLVLSYKSICSLGCDLPQTHSLRNRRALILLAQMGRISPFSCLKDRHEFR
FPEEEFDGHQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDFILAVRKYFQRITLYLMEKKYSPCAWEVVRAEIMRSFSFSTN
LKKGLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcccggtccttttctttactgatggtcgtgctggtactcagctacaaatccatctgc
tctctgggctgtgatctgcctcagacccacagcctgcgtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcttgaaggacagacatgaattcaga
ttcccagaggaggagtttgatggccaccagttccagaagactcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggacttcatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaaac
ttgaaaaaaggattaaggaggaaggattga

KEGG   Homo sapiens (human): 3445
Entry
3445              CDS       T01001                                 

Gene name
IFNA8, IFN-alphaB
Definition
(RefSeq) interferon alpha 8
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3445 (IFNA8)
   04151 PI3K-Akt signaling pathway
    3445 (IFNA8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3445 (IFNA8)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3445 (IFNA8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3445 (IFNA8)
   04621 NOD-like receptor signaling pathway
    3445 (IFNA8)
   04622 RIG-I-like receptor signaling pathway
    3445 (IFNA8)
   04623 Cytosolic DNA-sensing pathway
    3445 (IFNA8)
   04650 Natural killer cell mediated cytotoxicity
    3445 (IFNA8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3445 (IFNA8)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3445 (IFNA8)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3445 (IFNA8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3445 (IFNA8)
   05161 Hepatitis B
    3445 (IFNA8)
   05160 Hepatitis C
    3445 (IFNA8)
   05171 Coronavirus disease - COVID-19
    3445 (IFNA8)
   05164 Influenza A
    3445 (IFNA8)
   05162 Measles
    3445 (IFNA8)
   05168 Herpes simplex virus 1 infection
    3445 (IFNA8)
   05163 Human cytomegalovirus infection
    3445 (IFNA8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3445 (IFNA8)
   05169 Epstein-Barr virus infection
    3445 (IFNA8)
   05165 Human papillomavirus infection
    3445 (IFNA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3445 (IFNA8)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3445 (IFNA8)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 3445
NCBI-ProteinID: NP_002161
OMIM: 147568
HGNC: 5429
Ensembl: ENSG00000120242
Vega: OTTHUMG00000019677
Pharos: P32881(Tbio)
UniProt: P32881
LinkDB
Position
9p21.3
AA seq 189 aa
MALTFYLLVALVVLSYKSFSSLGCDLPQTHSLGNRRALILLAQMRRISPFSCLKDRHDFE
FPQEEFDDKQFQKAQAISVLHEMIQQTFNLFSTKDSSAALDETLLDEFYIELDQQLNDLE
SCVMQEVGVIESPLMYEDSILAVRKYFQRITLYLTEKKYSSCAWEVVRAEIMRSFSLSIN
LQKRLKSKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccttgactttttatttactggtggccctagtggtgctcagctacaagtcattcagc
tctctgggctgtgatctgcctcagactcacagcctgggtaacaggagggccttgatactc
ctggcacaaatgcgaagaatctctcctttctcctgcctgaaggacagacatgactttgaa
ttcccccaggaggagtttgatgataaacagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaacctcttcagcacaaaggactcatctgctgctttg
gatgagacccttctagatgaattctacatcgaacttgaccagcagctgaatgacctggag
tcctgtgtgatgcaggaagtgggggtgatagagtctcccctgatgtacgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctatatctgacagagaagaaatacagc
tcttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaatcaac
ttgcaaaaaagattgaagagtaaggaatga

KEGG   Homo sapiens (human): 3446
Entry
3446              CDS       T01001                                 

Gene name
IFNA10, IFN-alphaC
Definition
(RefSeq) interferon alpha 10
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3446 (IFNA10)
   04151 PI3K-Akt signaling pathway
    3446 (IFNA10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3446 (IFNA10)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3446 (IFNA10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3446 (IFNA10)
   04621 NOD-like receptor signaling pathway
    3446 (IFNA10)
   04622 RIG-I-like receptor signaling pathway
    3446 (IFNA10)
   04623 Cytosolic DNA-sensing pathway
    3446 (IFNA10)
   04650 Natural killer cell mediated cytotoxicity
    3446 (IFNA10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3446 (IFNA10)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3446 (IFNA10)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3446 (IFNA10)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3446 (IFNA10)
   05161 Hepatitis B
    3446 (IFNA10)
   05160 Hepatitis C
    3446 (IFNA10)
   05171 Coronavirus disease - COVID-19
    3446 (IFNA10)
   05164 Influenza A
    3446 (IFNA10)
   05162 Measles
    3446 (IFNA10)
   05168 Herpes simplex virus 1 infection
    3446 (IFNA10)
   05163 Human cytomegalovirus infection
    3446 (IFNA10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3446 (IFNA10)
   05169 Epstein-Barr virus infection
    3446 (IFNA10)
   05165 Human papillomavirus infection
    3446 (IFNA10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3446 (IFNA10)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3446 (IFNA10)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 3446
NCBI-ProteinID: NP_002162
OMIM: 147577
HGNC: 5418
Ensembl: ENSG00000186803
Vega: OTTHUMG00000019658
Pharos: P01566(Tbio)
UniProt: P01566
LinkDB
Position
9p21.3
AA seq 189 aa
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFR
IPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLIERKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttacttatggccgtgctggtgctcagctacaaatccatctgt
tctctaggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctgggacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgatttccga
atcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaatagagaggaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctcgttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Homo sapiens (human): 3447
Entry
3447              CDS       T01001                                 

Gene name
IFNA13
Definition
(RefSeq) interferon alpha 13
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3447 (IFNA13)
   04151 PI3K-Akt signaling pathway
    3447 (IFNA13)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3447 (IFNA13)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3447 (IFNA13)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3447 (IFNA13)
   04621 NOD-like receptor signaling pathway
    3447 (IFNA13)
   04622 RIG-I-like receptor signaling pathway
    3447 (IFNA13)
   04623 Cytosolic DNA-sensing pathway
    3447 (IFNA13)
   04650 Natural killer cell mediated cytotoxicity
    3447 (IFNA13)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3447 (IFNA13)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3447 (IFNA13)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3447 (IFNA13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3447 (IFNA13)
   05161 Hepatitis B
    3447 (IFNA13)
   05160 Hepatitis C
    3447 (IFNA13)
   05171 Coronavirus disease - COVID-19
    3447 (IFNA13)
   05164 Influenza A
    3447 (IFNA13)
   05162 Measles
    3447 (IFNA13)
   05168 Herpes simplex virus 1 infection
    3447 (IFNA13)
   05163 Human cytomegalovirus infection
    3447 (IFNA13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3447 (IFNA13)
   05169 Epstein-Barr virus infection
    3447 (IFNA13)
   05165 Human papillomavirus infection
    3447 (IFNA13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3447 (IFNA13)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3447 (IFNA13)
SSDB
Motif
Pfam: Interferon CBF
Other DBs
NCBI-GeneID: 3447
NCBI-ProteinID: NP_008831
OMIM: 147578
HGNC: 5419
Ensembl: ENSG00000233816
Vega: OTTHUMG00000019675
Pharos: P01562(Tbio)
UniProt: P01562 A0A087WWS6
LinkDB
Structure
PDB: 
3UX9

Position
9p21.3
AA seq 190 aa
MMASPFALLMALVVLSCKSSCSLGCDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDF
GFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDL
EACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLST
NLQERLRRKE
NT seq 573 nt   +upstreamnt  +downstreamnt
atgatggcctcgccctttgctttactgatggccctggtggtgctcagctgcaagtcaagc
tgctctctgggctgtgatctccctgagacccacagcctggataacaggaggaccttgatg
ctcctggcacaaatgagcagaatctctccttcctcctgtctgatggacagacatgacttt
ggatttccccaggaggagtttgatggcaaccagttccagaaggctccagccatctctgtc
ctccatgagctgatccagcagatcttcaacctctttaccacaaaagattcatctgctgct
tgggatgaggacctcctagacaaattctgcaccgaactctaccagcagctgaatgacttg
gaagcctgtgtgatgcaggaggagagggtgggagaaactcccctgatgaatgcggactcc
atcttggctgtgaagaaatacttccgaagaatcactctctatctgacagagaagaaatac
agcccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttatcaaca
aacttgcaagaaagattaaggaggaaggaataa

KEGG   Homo sapiens (human): 3448
Entry
3448              CDS       T01001                                 

Gene name
IFNA14, IFN-alphaH, LEIF2H
Definition
(RefSeq) interferon alpha 14
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3448 (IFNA14)
   04151 PI3K-Akt signaling pathway
    3448 (IFNA14)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3448 (IFNA14)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3448 (IFNA14)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3448 (IFNA14)
   04621 NOD-like receptor signaling pathway
    3448 (IFNA14)
   04622 RIG-I-like receptor signaling pathway
    3448 (IFNA14)
   04623 Cytosolic DNA-sensing pathway
    3448 (IFNA14)
   04650 Natural killer cell mediated cytotoxicity
    3448 (IFNA14)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3448 (IFNA14)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3448 (IFNA14)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3448 (IFNA14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3448 (IFNA14)
   05161 Hepatitis B
    3448 (IFNA14)
   05160 Hepatitis C
    3448 (IFNA14)
   05171 Coronavirus disease - COVID-19
    3448 (IFNA14)
   05164 Influenza A
    3448 (IFNA14)
   05162 Measles
    3448 (IFNA14)
   05168 Herpes simplex virus 1 infection
    3448 (IFNA14)
   05163 Human cytomegalovirus infection
    3448 (IFNA14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3448 (IFNA14)
   05169 Epstein-Barr virus infection
    3448 (IFNA14)
   05165 Human papillomavirus infection
    3448 (IFNA14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3448 (IFNA14)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3448 (IFNA14)
SSDB
Motif
Pfam: Interferon APC1_C
Other DBs
NCBI-GeneID: 3448
NCBI-ProteinID: NP_002163
OMIM: 147579
HGNC: 5420
Ensembl: ENSG00000228083
Vega: OTTHUMG00000019665
Pharos: P01570(Tdark)
UniProt: P01570
LinkDB
Position
9p21.3
AA seq 189 aa
MALPFALMMALVVLSCKSSCSLGCNLSQTHSLNNRRTLMLMAQMRRISPFSCLKDRHDFE
FPQEEFDGNQFQKAQAISVLHEMMQQTFNLFSTKNSSAAWDETLLEKFYIELFQQMNDLE
ACVIQEVGVEETPLMNEDSILAVKKYFQRITLYLMEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggcattgccctttgctttaatgatggccctggtggtgctcagctgcaagtcaagctgc
tctctgggctgtaatctgtctcaaacccacagcctgaataacaggaggactttgatgctc
atggcacaaatgaggagaatctctcctttctcctgcctgaaggacagacatgactttgaa
tttccccaggaggaatttgatggcaaccagttccagaaagctcaagccatctctgtcctc
catgagatgatgcagcagaccttcaatctcttcagcacaaagaactcatctgctgcttgg
gatgagaccctcctagaaaaattctacattgaacttttccagcaaatgaatgacctggaa
gcctgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaagaaatacttccaaagaatcactctttatctgatggagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctctttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

KEGG   Homo sapiens (human): 3449
Entry
3449              CDS       T01001                                 

Gene name
IFNA16, IFN-alpha-16, IFN-alphaO
Definition
(RefSeq) interferon alpha 16
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3449 (IFNA16)
   04151 PI3K-Akt signaling pathway
    3449 (IFNA16)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3449 (IFNA16)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3449 (IFNA16)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3449 (IFNA16)
   04621 NOD-like receptor signaling pathway
    3449 (IFNA16)
   04622 RIG-I-like receptor signaling pathway
    3449 (IFNA16)
   04623 Cytosolic DNA-sensing pathway
    3449 (IFNA16)
   04650 Natural killer cell mediated cytotoxicity
    3449 (IFNA16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3449 (IFNA16)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3449 (IFNA16)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3449 (IFNA16)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3449 (IFNA16)
   05161 Hepatitis B
    3449 (IFNA16)
   05160 Hepatitis C
    3449 (IFNA16)
   05171 Coronavirus disease - COVID-19
    3449 (IFNA16)
   05164 Influenza A
    3449 (IFNA16)
   05162 Measles
    3449 (IFNA16)
   05168 Herpes simplex virus 1 infection
    3449 (IFNA16)
   05163 Human cytomegalovirus infection
    3449 (IFNA16)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3449 (IFNA16)
   05169 Epstein-Barr virus infection
    3449 (IFNA16)
   05165 Human papillomavirus infection
    3449 (IFNA16)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3449 (IFNA16)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3449 (IFNA16)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 3449
NCBI-ProteinID: NP_002164
OMIM: 147580
HGNC: 5421
Ensembl: ENSG00000147885
Vega: OTTHUMG00000019663
Pharos: P05015(Tdark)
UniProt: P05015
LinkDB
Position
9p21.3
AA seq 189 aa
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFG
FPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLE
ACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTN
LQKGLRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagactcacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcatttctcctgcctgaaggacagatatgatttcgga
ttcccccaggaggtgtttgatggcaaccagttccagaaggctcaagccatctctgccttc
catgagatgatccagcagaccttcaatctcttcagcacaaaggattcatctgctgcttgg
gatgagaccctcctagacaaattctacattgaacttttccagcaactgaatgacctagaa
gcctgtgtgacacaggaggttggggtggaagagattgccctgatgaatgaggactccatc
ctggctgtgaggaaatactttcaaagaatcactctttatctgatggggaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttttcaacaaac
ttgcaaaaaggattaagaaggaaggattga

KEGG   Homo sapiens (human): 3451
Entry
3451              CDS       T01001                                 

Gene name
IFNA17, IFN-alphaI, IFNA, INFA, LEIF2C1
Definition
(RefSeq) interferon alpha 17
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3451 (IFNA17)
   04151 PI3K-Akt signaling pathway
    3451 (IFNA17)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3451 (IFNA17)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3451 (IFNA17)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3451 (IFNA17)
   04621 NOD-like receptor signaling pathway
    3451 (IFNA17)
   04622 RIG-I-like receptor signaling pathway
    3451 (IFNA17)
   04623 Cytosolic DNA-sensing pathway
    3451 (IFNA17)
   04650 Natural killer cell mediated cytotoxicity
    3451 (IFNA17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3451 (IFNA17)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3451 (IFNA17)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3451 (IFNA17)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3451 (IFNA17)
   05161 Hepatitis B
    3451 (IFNA17)
   05160 Hepatitis C
    3451 (IFNA17)
   05171 Coronavirus disease - COVID-19
    3451 (IFNA17)
   05164 Influenza A
    3451 (IFNA17)
   05162 Measles
    3451 (IFNA17)
   05168 Herpes simplex virus 1 infection
    3451 (IFNA17)
   05163 Human cytomegalovirus infection
    3451 (IFNA17)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3451 (IFNA17)
   05169 Epstein-Barr virus infection
    3451 (IFNA17)
   05165 Human papillomavirus infection
    3451 (IFNA17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3451 (IFNA17)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3451 (IFNA17)
SSDB
Motif
Pfam: Interferon DUF4164
Other DBs
NCBI-GeneID: 3451
NCBI-ProteinID: NP_067091
OMIM: 147583
HGNC: 5422
Ensembl: ENSG00000234829
Vega: OTTHUMG00000019667
Pharos: P01571(Tbio)
UniProt: P01571
LinkDB
Position
9p21.3
AA seq 189 aa
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
LPQEEFDGNQFQKTQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNNLE
ACVIQEVGMEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKILRRKD
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctaggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
cttccccaggaggagtttgatggcaaccagttccagaagactcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaataacctggaa
gcatgtgtgatacaggaggttgggatggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatctctctctttttcaacaaac
ttgcaaaaaatattaaggaggaaggattga

KEGG   Homo sapiens (human): 3452
Entry
3452              CDS       T01001                                 

Gene name
IFNA21, IFN-alphaI, LeIF_F, leIF-F
Definition
(RefSeq) interferon alpha 21
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3452 (IFNA21)
   04151 PI3K-Akt signaling pathway
    3452 (IFNA21)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3452 (IFNA21)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3452 (IFNA21)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3452 (IFNA21)
   04621 NOD-like receptor signaling pathway
    3452 (IFNA21)
   04622 RIG-I-like receptor signaling pathway
    3452 (IFNA21)
   04623 Cytosolic DNA-sensing pathway
    3452 (IFNA21)
   04650 Natural killer cell mediated cytotoxicity
    3452 (IFNA21)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3452 (IFNA21)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3452 (IFNA21)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3452 (IFNA21)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3452 (IFNA21)
   05161 Hepatitis B
    3452 (IFNA21)
   05160 Hepatitis C
    3452 (IFNA21)
   05171 Coronavirus disease - COVID-19
    3452 (IFNA21)
   05164 Influenza A
    3452 (IFNA21)
   05162 Measles
    3452 (IFNA21)
   05168 Herpes simplex virus 1 infection
    3452 (IFNA21)
   05163 Human cytomegalovirus infection
    3452 (IFNA21)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3452 (IFNA21)
   05169 Epstein-Barr virus infection
    3452 (IFNA21)
   05165 Human papillomavirus infection
    3452 (IFNA21)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3452 (IFNA21)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3452 (IFNA21)
SSDB
Motif
Pfam: Interferon
Other DBs
NCBI-GeneID: 3452
NCBI-ProteinID: NP_002166
OMIM: 147584
HGNC: 5424
Ensembl: ENSG00000137080
Vega: OTTHUMG00000019653
Pharos: P01568(Tbio)
UniProt: P01568
LinkDB
Position
9p21.3
AA seq 189 aa
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFG
FPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLE
ACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKI
FQERLRRKE
NT seq 570 nt   +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcctttctcctgcctgaaggacagacatgactttgga
ttcccccaggaggagtttgatggcaaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacaaaggactcatctgctacttgg
gaacagagcctcctagaaaaattttccactgaacttaaccagcagctgaatgacctggaa
gcctgcgtgatacaggaggttggggtggaagagactcccctgatgaatgtggactccatc
ctggctgtgaagaaatacttccaaagaatcactctttatctgacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccttctctttatcaaaaatt
tttcaagaaagattaaggaggaaggaatga

KEGG   Homo sapiens (human): 3456
Entry
3456              CDS       T01001                                 

Gene name
IFNB1, IFB, IFF, IFN-beta, IFNB
Definition
(RefSeq) interferon beta 1
  KO
K05415  interferon beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04380  Osteoclast differentiation
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04668  TNF signaling pathway
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05171  Coronavirus disease - COVID-19
Network
nt06121  TLR signaling (viruses and bacteria)
nt06122  IFN signaling (viruses)
nt06123  TNF signaling (viruses and bacteria)
nt06133  RLR signaling (viruses)
nt06134  CGAS-STING signaling (viruses and bacteria)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06171  Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00149  TLR3-IRF3 signaling pathway
N00150  Type I IFN signaling pathway
N00374  TNF-IRF1 signaling pathway
N00395  cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00553  TLR4-IRF3/7 signaling pathway
N00686  MV N to RIG-I-IRF7/3 signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N01308  MDA5-IRF7/3 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3456 (IFNB1)
   04668 TNF signaling pathway
    3456 (IFNB1)
   04151 PI3K-Akt signaling pathway
    3456 (IFNB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3456 (IFNB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3456 (IFNB1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3456 (IFNB1)
   04621 NOD-like receptor signaling pathway
    3456 (IFNB1)
   04622 RIG-I-like receptor signaling pathway
    3456 (IFNB1)
   04623 Cytosolic DNA-sensing pathway
    3456 (IFNB1)
   04650 Natural killer cell mediated cytotoxicity
    3456 (IFNB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    3456 (IFNB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    3456 (IFNB1)
   05135 Yersinia infection
    3456 (IFNB1)
   05152 Tuberculosis
    3456 (IFNB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3456 (IFNB1)
   05161 Hepatitis B
    3456 (IFNB1)
   05160 Hepatitis C
    3456 (IFNB1)
   05171 Coronavirus disease - COVID-19
    3456 (IFNB1)
   05164 Influenza A
    3456 (IFNB1)
   05162 Measles
    3456 (IFNB1)
   05168 Herpes simplex virus 1 infection
    3456 (IFNB1)
   05163 Human cytomegalovirus infection
    3456 (IFNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3456 (IFNB1)
   05169 Epstein-Barr virus infection
    3456 (IFNB1)
   05165 Human papillomavirus infection
    3456 (IFNB1)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    3456 (IFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3456 (IFNB1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3456 (IFNB1)
SSDB
Motif
Pfam: Interferon Forkhead Ribosomal_S15
Other DBs
NCBI-GeneID: 3456
NCBI-ProteinID: NP_002167
OMIM: 147640
HGNC: 5434
Ensembl: ENSG00000171855
Vega: OTTHUMG00000019652
Pharos: P01574(Tbio)
UniProt: P01574
LinkDB
Structure
PDB: 
1AU1

Position
9p21.3
AA seq 187 aa
MTNKCLLQIALLLCFSTTALSMSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFD
IPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLK
TVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINR
LTGYLRN
NT seq 564 nt   +upstreamnt  +downstreamnt
atgaccaacaagtgtctcctccaaattgctctcctgttgtgcttctccactacagctctt
tccatgagctacaacttgcttggattcctacaaagaagcagcaattttcagtgtcagaag
ctcctgtggcaattgaatgggaggcttgaatactgcctcaaggacaggatgaactttgac
atccctgaggagattaagcagctgcagcagttccagaaggaggacgccgcattgaccatc
tatgagatgctccagaacatctttgctattttcagacaagattcatctagcactggctgg
aatgagactattgttgagaacctcctggctaatgtctatcatcagataaaccatctgaag
acagtcctggaagaaaaactggagaaagaagatttcaccaggggaaaactcatgagcagt
ctgcacctgaaaagatattatgggaggattctgcattacctgaaggccaaggagtacagt
cactgtgcctggaccatagtcagagtggaaatcctaaggaacttttacttcattaacaga
cttacaggttacctccgaaactga

KEGG   Homo sapiens (human): 3458
Entry
3458              CDS       T01001                                 

Gene name
IFNG, IFG, IFI, IMD69
Definition
(RefSeq) interferon gamma
  KO
K04687  interferon gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa03050  Proteasome
hsa04060  Cytokine-cytokine receptor interaction
hsa04066  HIF-1 signaling pathway
hsa04217  Necroptosis
hsa04350  TGF-beta signaling pathway
hsa04380  Osteoclast differentiation
hsa04612  Antigen processing and presentation
hsa04630  JAK-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04940  Type I diabetes mellitus
hsa05140  Leishmaniasis
hsa05142  Chagas disease
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05145  Toxoplasmosis
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05164  Influenza A
hsa05168  Herpes simplex virus 1 infection
hsa05200  Pathways in cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05321  Inflammatory bowel disease
hsa05322  Systemic lupus erythematosus
hsa05323  Rheumatoid arthritis
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06119  JAK-STAT signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00083  Allograft rejection
H00084  Graft-versus-host disease
H01132  Aplastic anemia
Drug target
Darvadstrocel: D11397
Emapalumab: D11120<US>
Fontolizumab: D04242
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    3458 (IFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    3458 (IFNG)
   04630 JAK-STAT signaling pathway
    3458 (IFNG)
   04066 HIF-1 signaling pathway
    3458 (IFNG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3458 (IFNG)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3458 (IFNG)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3458 (IFNG)
   04612 Antigen processing and presentation
    3458 (IFNG)
   04660 T cell receptor signaling pathway
    3458 (IFNG)
   04658 Th1 and Th2 cell differentiation
    3458 (IFNG)
   04659 Th17 cell differentiation
    3458 (IFNG)
   04657 IL-17 signaling pathway
    3458 (IFNG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    3458 (IFNG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3458 (IFNG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    3458 (IFNG)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3458 (IFNG)
   05323 Rheumatoid arthritis
    3458 (IFNG)
   05321 Inflammatory bowel disease
    3458 (IFNG)
   05330 Allograft rejection
    3458 (IFNG)
   05332 Graft-versus-host disease
    3458 (IFNG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    3458 (IFNG)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3458 (IFNG)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3458 (IFNG)
  09172 Infectious disease: viral
   05160 Hepatitis C
    3458 (IFNG)
   05164 Influenza A
    3458 (IFNG)
   05168 Herpes simplex virus 1 infection
    3458 (IFNG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3458 (IFNG)
   05144 Malaria
    3458 (IFNG)
   05145 Toxoplasmosis
    3458 (IFNG)
   05140 Leishmaniasis
    3458 (IFNG)
   05142 Chagas disease
    3458 (IFNG)
   05143 African trypanosomiasis
    3458 (IFNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:hsa03051]
    3458 (IFNG)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3458 (IFNG)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3458 (IFNG)
Proteasome [BR:hsa03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    3458 (IFNG)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3458 (IFNG)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Cytokines
   3458 (IFNG)
SSDB
Motif
Pfam: IFN-gamma API5 Tup_N
Other DBs
NCBI-GeneID: 3458
NCBI-ProteinID: NP_000610
OMIM: 147570
HGNC: 5438
Ensembl: ENSG00000111537
Vega: OTTHUMG00000169113
Pharos: P01579(Tbio)
UniProt: P01579
LinkDB
Structure
PDB: 

Position
12q15
AA seq 166 aa
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaaatatacaagttatatcttggcttttcagctctgcatcgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca
ggtcattcagatgtagcggataatggaactcttttcttaggcattttgaagaattggaaa
gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt
aaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatg
aatgtcaagtttttcaatagcaacaaaaagaaacgagatgacttcgaaaagctgactaat
tattcggtaactgacttgaatgtccaacgcaaagcaatacatgaactcatccaagtgatg
gctgaactgtcgccagcagctaaaacagggaagcgaaaaaggagtcagatgctgtttcga
ggtcgaagagcatcccagtaa

DBGET integrated database retrieval system