Entry |
|
Gene name |
IFNA2, IFN-alpha-2, IFN-alphaA, IFNA, IFNA2B, leIF_A
|
Definition |
(RefSeq) interferon alpha 2
|
KO |
|
Organism |
|
Pathway |
hsa04060 | Cytokine-cytokine receptor interaction |
hsa04620 | Toll-like receptor signaling pathway |
hsa04621 | NOD-like receptor signaling pathway |
hsa04622 | RIG-I-like receptor signaling pathway |
hsa04650 | Natural killer cell mediated cytotoxicity |
hsa05163 | Human cytomegalovirus infection |
hsa05167 | Kaposi sarcoma-associated herpesvirus infection |
hsa05168 | Herpes simplex virus 1 infection |
hsa05170 | Human immunodeficiency virus 1 infection |
|
Network |
nt06121 TLR signaling (viruses and bacteria) nt06122 IFN signaling (viruses) nt06133 RLR signaling (viruses) nt06134 CGAS-STING signaling (viruses and bacteria) nt06161 Human immunodeficiency virus type 1 (HIV-1) nt06162 Hepatitis B virus (HBV) nt06163 Hepatitis C virus (HCV) nt06164 Kaposi sarcoma-associated herpesvirus (KSHV) nt06165 Epstein-Barr virus (EBV) nt06166 Human papillomavirus (HPV) nt06167 Human cytomegalovirus (HCMV) nt06168 Herpes simplex virus 1 (HSV-1) nt06169 Measles virus (MV) nt06170 Influenza A virus (IAV) nt06171 Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) nt06221 TLR signaling nt06222 IFN signaling nt06263 Hepatocellular carcinoma |
Element |
N00148 | TLR3-IRF7 signaling pathway |
N00150 | Type I IFN signaling pathway |
N00395 | cGAS-STING signaling pathway |
N00436 | HIV Tat to TLR2/4-NFKB signaling pathway |
N00469 | RIG-I-IRF7/3 signaling pathway |
N00688 | RIG-I-NFKB signaling pathway |
N00690 | TLR7/9-IRF7 signaling pathway |
N01308 | MDA5-IRF7/3 signaling pathway |
|
Drug target |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04630 JAK-STAT signaling pathway
3440 (IFNA2)
04151 PI3K-Akt signaling pathway
3440 (IFNA2)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
3440 (IFNA2)
09140 Cellular Processes
09143 Cell growth and death
04217 Necroptosis
3440 (IFNA2)
09150 Organismal Systems
09151 Immune system
04620 Toll-like receptor signaling pathway
3440 (IFNA2)
04621 NOD-like receptor signaling pathway
3440 (IFNA2)
04622 RIG-I-like receptor signaling pathway
3440 (IFNA2)
04623 Cytosolic DNA-sensing pathway
3440 (IFNA2)
04650 Natural killer cell mediated cytotoxicity
3440 (IFNA2)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
3440 (IFNA2)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
3440 (IFNA2)
05161 Hepatitis B
3440 (IFNA2)
05160 Hepatitis C
3440 (IFNA2)
05171 Coronavirus disease - COVID-19
3440 (IFNA2)
05164 Influenza A
3440 (IFNA2)
05162 Measles
3440 (IFNA2)
05168 Herpes simplex virus 1 infection
3440 (IFNA2)
05163 Human cytomegalovirus infection
3440 (IFNA2)
05167 Kaposi sarcoma-associated herpesvirus infection
3440 (IFNA2)
05169 Epstein-Barr virus infection
3440 (IFNA2)
05165 Human papillomavirus infection
3440 (IFNA2)
09171 Infectious disease: bacterial
05152 Tuberculosis
3440 (IFNA2)
09163 Immune disease
05320 Autoimmune thyroid disease
3440 (IFNA2)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04052 Cytokines and growth factors [BR:hsa04052]
3440 (IFNA2)
Cytokines and growth factors [BR:hsa04052]
Cytokines
Interferons
3440 (IFNA2)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Structure |
PDB: |
Position |
9p21.3
|
AA seq |
188 aa
MALTFALLVALLVLSCKSSCSVGCDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFG
FPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEA
CVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNL
QESLRSKE |
NT seq |
567 nt +upstreamnt +downstreamnt
atggccttgacctttgctttactggtggccctcctggtgctcagctgcaagtcaagctgc
tctgtgggctgtgatctgcctcaaacccacagcctgggtagcaggaggaccttgatgctc
ctggcacagatgaggagaatctctcttttctcctgcttgaaggacagacatgactttgga
tttccccaggaggagtttggcaaccagttccaaaaggctgaaaccatccctgtcctccat
gagatgatccagcagatcttcaatctcttcagcacaaaggactcatctgctgcttgggat
gagaccctcctagacaaattctacactgaactctaccagcagctgaatgacctggaagcc
tgtgtgatacagggggtgggggtgacagagactcccctgatgaaggaggactccattctg
gctgtgaggaaatacttccaaagaatcactctctatctgaaagagaagaaatacagccct
tgtgcctgggaggttgtcagagcagaaatcatgagatctttttctttgtcaacaaacttg
caagaaagtttaagaagtaaggaatga |