KEGG   Homo sapiens (human): 3441Help
Entry
3441              CDS       T01001                                 

Gene name
IFNA4, IFN-alpha4a, INFA4
Definition
(RefSeq) interferon alpha 4
  KO
K05414  interferon alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04622  RIG-I-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04630  Jak-STAT signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa05152  Tuberculosis
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05320  Autoimmune thyroid disease
Network
nt06121  TLR signaling (virus)
nt06122  IFN signaling (virus)
nt06133  RIG-I signaling (virus)
nt06134  CGAS-STING signaling (virus)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06221  TLR signaling
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00148  TLR3-IRF7 signaling pathway
N00150  Type I IFN signaling pathway
N00162  KSHV vIRF3 to TLR3-IRF7 signaling pathway
N00163  KSHV KIE1/2 to TLR3-IRF7 signaling pathway
N00395  cGAS-STING signaling pathway
N00396  HCMV UL82 to cGAS-STING signaling pathway
N00436  HIV Tat to TLR2/4-NFKB signaling pathway
N00437  HIV Vpu to TLR2/4-NFKB signaling pathway
N00440  HIV Vpu/Vif/Vpr to cGAS-STING signaling pathway
N00469  RIG-I-IRF7/3 signaling pathway
N00470  EBV BGLF4 to RIG-I-like receptor signaling pathway
N00565  HSV US11 to RIG-I-like receptor signaling pathway
N00566  HSV UL36USP to RIG-I-like receptor signaling pathway
N00567  HSV ICP34.5 to TBK1 signaling pathway
N00569  HSV UL41 to cGAS-STING signaling pathway
N00570  HSV ICP0 to cGAS-STING signaling pathway
N00688  RIG-I-NFKB signaling pathway
N00689  MV V/P/C to RIG-I-NFKB signaling pathway
N00690  TLR7/9-IRF7 signaling pathway
N00691  MV V to TLR7/9-IRF7 signaling pathway
N00692  MV P to TLR2/4-NFKB signaling pathway
N00730  IAV NS1 to RIG-I-like receptor signaling pathway
Drug target
Rontalizumab: D09662
Sifalimumab: D09668
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3441 (IFNA4)
   04151 PI3K-Akt signaling pathway
    3441 (IFNA4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3441 (IFNA4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3441 (IFNA4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    3441 (IFNA4)
   04621 NOD-like receptor signaling pathway
    3441 (IFNA4)
   04622 RIG-I-like receptor signaling pathway
    3441 (IFNA4)
   04623 Cytosolic DNA-sensing pathway
    3441 (IFNA4)
   04650 Natural killer cell mediated cytotoxicity
    3441 (IFNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3441 (IFNA4)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3441 (IFNA4)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    3441 (IFNA4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    3441 (IFNA4)
   05162 Measles
    3441 (IFNA4)
   05164 Influenza A
    3441 (IFNA4)
   05161 Hepatitis B
    3441 (IFNA4)
   05160 Hepatitis C
    3441 (IFNA4)
   05168 Herpes simplex virus 1 infection
    3441 (IFNA4)
   05163 Human cytomegalovirus infection
    3441 (IFNA4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3441 (IFNA4)
   05169 Epstein-Barr virus infection
    3441 (IFNA4)
   05165 Human papillomavirus infection
    3441 (IFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3441 (IFNA4)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3441 (IFNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 3441
NCBI-ProteinID: NP_066546
OMIM: 147564
HGNC: 5425
Ensembl: ENSG00000236637
Vega: OTTHUMG00000019660
Pharos: P05014(Tbio)
UniProt: P05014
LinkDB All DBs
Position
9p21.3
AA seq 189 aa AA seqDB search
MALSFSLLMAVLVLSYKSICSLGCDLPQTHSLGNRRALILLAQMGRISHFSCLKDRHDFG
FPEEEFDGHQFQKAQAISVLHEMIQQTFNLFSTEDSSAAWEQSLLEKFSTELYQQLNDLE
ACVIQEVGVEETPLMNEDSILAVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSLSFSTN
LQKRLRRKD
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggccctgtccttttctttactgatggccgtgctggtgctcagctacaaatccatctgt
tctctgggctgtgatctgcctcagacccacagcctgggtaataggagggccttgatactc
ctggcacaaatgggaagaatctctcatttctcctgcctgaaggacagacatgatttcgga
ttccccgaggaggagtttgatggccaccagttccagaaggctcaagccatctctgtcctc
catgagatgatccagcagaccttcaatctcttcagcacagaggactcatctgctgcttgg
gaacagagcctcctagaaaaattttccactgaactttaccagcaactgaatgacctggaa
gcatgtgtgatacaggaggttggggtggaagagactcccctgatgaatgaggactccatc
ctggctgtgaggaaatacttccaaagaatcactctttatctaacagagaagaaatacagc
ccttgtgcctgggaggttgtcagagcagaaatcatgagatccctctcgttttcaacaaac
ttgcaaaaaagattaaggaggaaggattga

DBGET integrated database retrieval system