KEGG   Homo sapiens (human): 345456Help
Entry
345456            CDS       T01001                                 

Gene name
PFN3
Definition
(RefSeq) profilin 3
  KO
K05759  profilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    345456 (PFN3)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    345456 (PFN3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    345456 (PFN3)
   05131 Shigellosis
    345456 (PFN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    345456 (PFN3)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    345456 (PFN3)
   04147 Exosome [BR:hsa04147]
    345456 (PFN3)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    345456 (PFN3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     345456 (PFN3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   345456 (PFN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 345456
NCBI-ProteinID: NP_001025057
OMIM: 612812
HGNC: 18627
Ensembl: ENSG00000196570
Vega: OTTHUMG00000163408
Pharos: P60673(Tdark)
UniProt: P60673
LinkDB All DBs
Position
5q35.3
AA seq 137 aa AA seqDB search
MGDWKVYISAVLRDQRIDDVAIVGHADNSCVWASRPGGLLAAISPQEVGVLTGPDRHTFL
QAGLSVGGRRCCVIRDHLLAEGDGVLDARTKGLDARAVCVGRAPRALLVLMGRRGVHGGI
LNKTVHELIRGLRMQGA
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggcgactggaaggtctacatcagtgcagtgctgcgggaccagcgcatcgacgacgtg
gccatcgtgggccatgcggacaacagctgcgtgtgggcttcgcggcccgggggcctgctg
gcggccatctcgccgcaggaggtgggcgtgctcacggggccggacaggcacaccttcctg
caggcgggcctgagcgtggggggccgccgctgctgcgtcatccgcgaccacctgctggcc
gagggtgacggcgtgctggacgcacgcaccaaggggctggacgcgcgcgccgtgtgcgtg
ggccgtgcgccgcgcgcgctcctggtgctaatgggccgacgcggcgtacatgggggcatc
ctcaacaagacggtgcacgaactcatacgcgggctgcgcatgcagggcgcctag

KEGG   Homo sapiens (human): 375189Help
Entry
375189            CDS       T01001                                 

Gene name
PFN4
Definition
(RefSeq) profilin family member 4
  KO
K05759  profilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    375189 (PFN4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    375189 (PFN4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    375189 (PFN4)
   05131 Shigellosis
    375189 (PFN4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    375189 (PFN4)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    375189 (PFN4)
   04147 Exosome [BR:hsa04147]
    375189 (PFN4)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    375189 (PFN4)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     375189 (PFN4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   375189 (PFN4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin DUF1233 Mpt_N
Motif
Other DBs
NCBI-GeneID: 375189
NCBI-ProteinID: NP_955378
HGNC: 31103
Ensembl: ENSG00000176732
Vega: OTTHUMG00000090816
Pharos: Q8NHR9(Tdark)
UniProt: Q8NHR9
LinkDB All DBs
Position
2p23.3
AA seq 129 aa AA seqDB search
MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVTPSDVRTLVNGFAKNPLQAR
REGLYFKGKDYRCVRADEYSLYAKNENTGVVVVKTHLYLLVATYTEGMYPSICVEATESL
GDYLRKKGS
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt
gcagccctcatcaaaatccaggagcggagcttgtgtgtagcatcaccaggtttcaatgta
acgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttgcaagcccga
agagaaggactgtatttcaagggaaaagattacagatgtgtccgggcagatgaatattct
ctttatgccaaaaatgagaacactggtgtggttgtcgtgaagacccatctgtatcttctg
gtagcaacttacactgagggcatgtatcctagcatctgtgtggaagccacagagagcctg
ggagactacctaagaaaaaaaggaagttaa

KEGG   Homo sapiens (human): 5216Help
Entry
5216              CDS       T01001                                 

Gene name
PFN1, ALS18
Definition
(RefSeq) profilin 1
  KO
K05759  profilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
hsa05132  Salmonella infection
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5216 (PFN1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5216 (PFN1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5216 (PFN1)
   05131 Shigellosis
    5216 (PFN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5216 (PFN1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    5216 (PFN1)
   04147 Exosome [BR:hsa04147]
    5216 (PFN1)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    5216 (PFN1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     5216 (PFN1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5216 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 5216
NCBI-ProteinID: NP_005013
OMIM: 176610
HGNC: 8881
Ensembl: ENSG00000108518
Vega: OTTHUMG00000099396
Pharos: P07737(Tbio)
UniProt: P07737
LinkDB All DBs
Structure
PDB: 

Position
17p13.2
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY
VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH
GGLINKKCYEMASHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccgggtggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatcgtgggctacaaggactcgccctccgtctgggccgccgtccccgggaaaacgttc
gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac
gtgaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag
gatggggaatttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat
gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac
ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgttcccagtac
tga

KEGG   Homo sapiens (human): 5217Help
Entry
5217              CDS       T01001                                 

Gene name
PFN2, D3S1319E, PFL
Definition
(RefSeq) profilin 2
  KO
K05759  profilin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
hsa05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5217 (PFN2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5217 (PFN2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    5217 (PFN2)
   05131 Shigellosis
    5217 (PFN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    5217 (PFN2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    5217 (PFN2)
   04147 Exosome [BR:hsa04147]
    5217 (PFN2)
Membrane trafficking [BR:hsa04131]
 Others
  Actin-binding proteins
   Others
    5217 (PFN2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     5217 (PFN2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5217 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 5217
NCBI-ProteinID: NP_002619
OMIM: 176590
HGNC: 8882
Ensembl: ENSG00000070087
Vega: OTTHUMG00000159683
Pharos: P35080(Tbio)
UniProt: P35080
LinkDB All DBs
Structure
PDB: 

Position
3q25.1
AA seq 140 aa AA seqDB search
MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH
GGTLNKKAYELALYLRRSDV
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt
cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc
gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat
gtggctgtcggcagagctggtagagcattggttatagtcatgggaaaggaaggtgtccac
ggaggcacacttaacaagaaagcatatgaactcgctttatacctgaggaggtctgatgtg
taa

DBGET integrated database retrieval system