KEGG   Homo sapiens (human): 345611
Entry
345611            CDS       T01001                                 

Gene name
IRGM, IFI1, IRGM1, LRG-47, LRG47
Definition
(RefSeq) immunity related GTPase M
  KO
K14139  immunity-related GTPase family M protein [EC:3.6.5.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05145  Toxoplasmosis
Disease
H00286  Crohn disease
H01227  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    345611 (IRGM)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     345611 (IRGM)
SSDB
Motif
Pfam: IIGP MMR_HSR1 LYTB RsgA_GTPase SRP54
Other DBs
NCBI-GeneID: 345611
NCBI-ProteinID: NP_001139277
OMIM: 608212
HGNC: 29597
Ensembl: ENSG00000237693
Vega: OTTHUMG00000163647
Pharos: A1A4Y4(Tbio)
UniProt: A1A4Y4
LinkDB
Position
5q33.1
AA seq 181 aa
MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEG
KASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVAS
AQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCE
Y
NT seq 546 nt   +upstreamnt  +downstreamnt
atggaagccatgaatgttgagaaagcctcagcagatgggaacttgccagaggtgatctct
aacatcaaggagactctgaagatagtgtccaggacaccagttaacatcactatggcaggg
gactctggcaatgggatgtccaccttcatcagtgcccttcgaaacacaggacatgagggt
aaggcctcacctcctactgagctggtaaaagctacccaaagatgtgcctcctatttctct
tcccacttttcaaatgtggtgttgtgggacctgcctggcacagggtctgccaccacaacc
ctggagaactacctgatggaaatgcagttcaaccggtatgacttcatcatggttgcatct
gcacaattcagcatgaatcatgtgatgcttgccaaaaccgctgaggacatgggaaagaag
ttctacattgtctggaccaagctagacatggacctcagcacaggtgccctcccagaagtg
cagctactgcagatcagagaaaatgtcctggaaaatctccagaaggagcgggtatgtgaa
tactaa

DBGET integrated database retrieval system