Entry |
|
Gene name |
IFNG, IFG, IFI, IMD69
|
Definition |
(RefSeq) interferon gamma
|
KO |
|
Organism |
|
Pathway |
hsa04060 | Cytokine-cytokine receptor interaction |
hsa04612 | Antigen processing and presentation |
hsa04650 | Natural killer cell mediated cytotoxicity |
hsa04658 | Th1 and Th2 cell differentiation |
hsa04660 | T cell receptor signaling pathway |
hsa05168 | Herpes simplex virus 1 infection |
hsa05235 | PD-L1 expression and PD-1 checkpoint pathway in cancer |
hsa05418 | Fluid shear stress and atherosclerosis |
|
Network |
nt06119 JAK-STAT signaling (viruses) nt06160 Human T-cell leukemia virus 1 (HTLV-1) nt06162 Hepatitis B virus (HBV) nt06164 Kaposi sarcoma-associated herpesvirus (KSHV) nt06165 Epstein-Barr virus (EBV) nt06219 JAK-STAT signaling nt06263 Hepatocellular carcinoma nt06266 Non-small cell lung cancer nt06276 Chronic myeloid leukemia |
Element |
N00053 | Cytokine-Jak-STAT signaling pathway |
|
Disease |
H00084 | Graft-versus-host disease |
|
Drug target |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
03050 Proteasome
3458 (IFNG)
09130 Environmental Information Processing
09132 Signal transduction
04350 TGF-beta signaling pathway
3458 (IFNG)
04630 JAK-STAT signaling pathway
3458 (IFNG)
04066 HIF-1 signaling pathway
3458 (IFNG)
09133 Signaling molecules and interaction
04060 Cytokine-cytokine receptor interaction
3458 (IFNG)
09140 Cellular Processes
09143 Cell growth and death
04217 Necroptosis
3458 (IFNG)
09150 Organismal Systems
09151 Immune system
04650 Natural killer cell mediated cytotoxicity
3458 (IFNG)
04612 Antigen processing and presentation
3458 (IFNG)
04660 T cell receptor signaling pathway
3458 (IFNG)
04658 Th1 and Th2 cell differentiation
3458 (IFNG)
04659 Th17 cell differentiation
3458 (IFNG)
04657 IL-17 signaling pathway
3458 (IFNG)
09158 Development and regeneration
04380 Osteoclast differentiation
3458 (IFNG)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
3458 (IFNG)
05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
3458 (IFNG)
09172 Infectious disease: viral
05160 Hepatitis C
3458 (IFNG)
05164 Influenza A
3458 (IFNG)
05168 Herpes simplex virus 1 infection
3458 (IFNG)
09171 Infectious disease: bacterial
05152 Tuberculosis
3458 (IFNG)
09174 Infectious disease: parasitic
05146 Amoebiasis
3458 (IFNG)
05144 Malaria
3458 (IFNG)
05145 Toxoplasmosis
3458 (IFNG)
05140 Leishmaniasis
3458 (IFNG)
05142 Chagas disease
3458 (IFNG)
05143 African trypanosomiasis
3458 (IFNG)
09163 Immune disease
05322 Systemic lupus erythematosus
3458 (IFNG)
05323 Rheumatoid arthritis
3458 (IFNG)
05321 Inflammatory bowel disease
3458 (IFNG)
05330 Allograft rejection
3458 (IFNG)
05332 Graft-versus-host disease
3458 (IFNG)
09166 Cardiovascular disease
05418 Fluid shear stress and atherosclerosis
3458 (IFNG)
09167 Endocrine and metabolic disease
04940 Type I diabetes mellitus
3458 (IFNG)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03051 Proteasome [BR:hsa03051]
3458 (IFNG)
09183 Protein families: signaling and cellular processes
04052 Cytokines and growth factors [BR:hsa04052]
3458 (IFNG)
00536 Glycosaminoglycan binding proteins [BR:hsa00536]
3458 (IFNG)
Proteasome [BR:hsa03051]
Eukaryotic proteasome
Assembling factors
Other assembling factors
3458 (IFNG)
Cytokines and growth factors [BR:hsa04052]
Cytokines
Interferons
3458 (IFNG)
Glycosaminoglycan binding proteins [BR:hsa00536]
Heparan sulfate / Heparin
Cytokines
3458 (IFNG)
|
SSDB |
|
Motif |
|
Other DBs |
|
LinkDB |
|
Structure |
PDB: |
Position |
12q15
|
AA seq |
166 aa
MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWK
EESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTN
YSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ |
NT seq |
501 nt +upstreamnt +downstreamnt
atgaaatatacaagttatatcttggcttttcagctctgcatcgttttgggttctcttggc
tgttactgccaggacccatatgtaaaagaagcagaaaaccttaagaaatattttaatgca
ggtcattcagatgtagcggataatggaactcttttcttaggcattttgaagaattggaaa
gaggagagtgacagaaaaataatgcagagccaaattgtctccttttacttcaaacttttt
aaaaactttaaagatgaccagagcatccaaaagagtgtggagaccatcaaggaagacatg
aatgtcaagtttttcaatagcaacaaaaagaaacgagatgacttcgaaaagctgactaat
tattcggtaactgacttgaatgtccaacgcaaagcaatacatgaactcatccaagtgatg
gctgaactgtcgccagcagctaaaacagggaagcgaaaaaggagtcagatgctgtttcga
ggtcgaagagcatcccagtaa |