KEGG   Homo sapiens (human): 3467
Entry
3467              CDS       T01001                                 

Gene name
IFNW1
Definition
(RefSeq) interferon omega 1
  KO
K05440  interferon omega
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04622  RIG-I-like receptor signaling pathway
hsa04630  JAK-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    3467 (IFNW1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3467 (IFNW1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    3467 (IFNW1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3467 (IFNW1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   3467 (IFNW1)
SSDB
Motif
Pfam: Interferon CDT1_C
Other DBs
NCBI-GeneID: 3467
NCBI-ProteinID: NP_002168
OMIM: 147553
HGNC: 5448
Ensembl: ENSG00000177047
Vega: OTTHUMG00000019656
Pharos: P05000(Tbio)
UniProt: P05000
LinkDB
Structure
PDB: 
3SE4

Position
9p21.3
AA seq 195 aa
MALLFPLLAALVMTSYSPVGSLGCDLPQNHGLLSRNTLVLLHQMRRISPFLCLKDRRDFR
FPQEMVKGSQLQKAHVMSVLHEMLQQIFSLFHTERSSAAWNMTLLDQLHTGLHQQLQHLE
TCLLQVVGEGESAGAISSPALTLRRYFQGIRVYLKEKKYSDCAWEVVRMEIMKSLFLSTN
MQERLRSKDRDLGSS
NT seq 588 nt   +upstreamnt  +downstreamnt
atggccctcctgttccctctactggcagccctagtgatgaccagctatagccctgttgga
tctctgggctgtgatctgcctcagaaccatggcctacttagcaggaacaccttggtgctt
ctgcaccaaatgaggagaatctcccctttcttgtgtctcaaggacagaagagacttcagg
ttcccccaggagatggtaaaagggagccagttgcagaaggcccatgtcatgtctgtcctc
catgagatgctgcagcagatcttcagcctcttccacacagagcgctcctctgctgcctgg
aacatgaccctcctagaccaactccacactggacttcatcagcaactgcaacacctggag
acctgcttgctgcaggtagtgggagaaggagaatctgctggggcaattagcagccctgca
ctgaccttgaggaggtacttccagggaatccgtgtctacctgaaagagaagaaatacagc
gactgtgcctgggaagttgtcagaatggaaatcatgaaatccttgttcttatcaacaaac
atgcaagaaagactgagaagtaaagatagagacctgggctcatcttga

DBGET integrated database retrieval system