KEGG   Homo sapiens (human): 3476
Entry
3476              CDS       T01001                                 

Gene name
IGBP1, ALPHA-4, IBP1, alpha4
Definition
(RefSeq) immunoglobulin binding protein 1
  KO
K17606  immunoglobulin-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04136  Autophagy - other
hsa04140  Autophagy - animal
Disease
H01035  Corpus callosum, agenesis of, with mental retardation, ocular coloboma and micrognathia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    3476 (IGBP1)
   04136 Autophagy - other
    3476 (IGBP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    3476 (IGBP1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3476 (IGBP1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Other PP2-interacting proteins
     3476 (IGBP1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   Others
    3476 (IGBP1)
SSDB
Motif
Pfam: TAP42 Fer4_22 MDM31_MDM32 Ribosomal_60s Methyltrans_RNA
Other DBs
NCBI-GeneID: 3476
NCBI-ProteinID: NP_001542
OMIM: 300139
HGNC: 5461
Ensembl: ENSG00000089289
Vega: OTTHUMG00000021767
Pharos: P78318(Tbio)
UniProt: P78318
LinkDB
Structure
PDB: 
4IYP

Position
Xq13.1
AA seq 339 aa
MAAEDELQLPRLPELFETGRQLLDEVEVATEPAGSRIVQEKVFKGLDLLEKAAEMLSQLD
LFSRNEDLEEIASTDLKYLLVPAFQGALTMKQVNPSKRLDHLQRAREHFINYLTQCHCYH
VAEFELPKTMNNSAENHTANSSMAYPSLVAMASQRQAKIQRYKQKKELEHRLSAMKSAVE
SGQADDERVREYYLLHLQRWIDISLEEIESIDQEIKILRERDSSREASTSNSSRQERPPV
KPFILTRNMAQAKVFGAGYPSLPTMTVSDWYEQHRKYGALPDQGIAKAAPEEFRKAAQQQ
EEQEEKEEEDDEQTLHRAREWDDWKDTHPRGYGNRQNMG
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggctgctgaggacgagttacagctgccgcggctccccgagctgttcgaaactggtaga
cagttactggacgaagtagaagtggcgactgaacccgccggttcccggatagtccaggag
aaggtgttcaagggcttggacctccttgagaaggctgccgaaatgttatcgcagctcgac
ttgttcagccgaaatgaagatttggaagagattgcttccaccgacctgaagtaccttttg
gtgccagcgtttcaaggagccctcaccatgaaacaagtcaaccccagcaagcgtctagat
catttgcagcgggctcgagaacactttataaactacttaactcagtgccattgctatcat
gtggcagagtttgagctgcccaaaaccatgaacaactctgctgaaaatcacactgccaat
tcctccatggcttatcctagtctcgttgctatggcatctcaaagacaggctaaaatacag
agatacaagcagaagaaggagttggagcataggttgtctgcaatgaaatctgctgtggaa
agtggtcaagcagatgatgagcgtgttcgtgaatattatcttcttcaccttcagaggtgg
attgatatcagcttagaagagattgagagcattgaccaggaaataaagatcctgagagaa
agagactcttcaagagaggcatcaacttctaactcatctcgccaggagaggcctccagtg
aaacccttcattctcactcggaacatggctcaagccaaagtatttggagctggttatcca
agtctgccaactatgacggtgagtgactggtatgagcaacatcggaaatatggagcatta
ccggatcagggaatagccaaggcagcaccagaggaattcagaaaagcagctcagcaacag
gaagaacaagaagaaaaggaggaagaggatgatgaacaaacactccacagagcccgggag
tgggatgactggaaggacacccatcctaggggctatgggaaccgacagaacatgggctga

DBGET integrated database retrieval system