KEGG   Homo sapiens (human): 3479Help
Entry
3479              CDS       T01001                                 

Gene name
IGF1, IGF, IGF-I, IGFI, MGF
Definition
(RefSeq) insulin like growth factor 1
  KO
K05459  insulin-like growth factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04114  Oocyte meiosis
hsa04115  p53 signaling pathway
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04510  Focal adhesion
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04730  Long-term depression
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa04935  Growth hormone synthesis, secretion and action
hsa04960  Aldosterone-regulated sodium reabsorption
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Network
nt06114  PI3K signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06214  PI3K signaling
nt06240  Transcription
  Element
N00133  EWSR1-FLI1 fusion to transcriptional activation
N00135  EWSR1-ERG fusion to transcriptional activation
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00582  IGF-IGF1R-PI3K signaling pathway
Disease
H00015  Malignant pleural mesothelioma
H02040  Insulin-like growth factor I deficiency
Drug target
Masoprocol: D04862
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    3479 (IGF1)
   04015 Rap1 signaling pathway
    3479 (IGF1)
   04010 MAPK signaling pathway
    3479 (IGF1)
   04066 HIF-1 signaling pathway
    3479 (IGF1)
   04068 FoxO signaling pathway
    3479 (IGF1)
   04151 PI3K-Akt signaling pathway
    3479 (IGF1)
   04152 AMPK signaling pathway
    3479 (IGF1)
   04150 mTOR signaling pathway
    3479 (IGF1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    3479 (IGF1)
   04115 p53 signaling pathway
    3479 (IGF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3479 (IGF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    3479 (IGF1)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    3479 (IGF1)
   04914 Progesterone-mediated oocyte maturation
    3479 (IGF1)
   04935 Growth hormone synthesis, secretion and action
    3479 (IGF1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    3479 (IGF1)
  09156 Nervous system
   04730 Long-term depression
    3479 (IGF1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    3479 (IGF1)
  09149 Aging
   04211 Longevity regulating pathway
    3479 (IGF1)
   04213 Longevity regulating pathway - multiple species
    3479 (IGF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3479 (IGF1)
   05202 Transcriptional misregulation in cancer
    3479 (IGF1)
   05205 Proteoglycans in cancer
    3479 (IGF1)
  09162 Cancer: specific types
   05214 Glioma
    3479 (IGF1)
   05218 Melanoma
    3479 (IGF1)
   05215 Prostate cancer
    3479 (IGF1)
   05224 Breast cancer
    3479 (IGF1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3479 (IGF1)
   05414 Dilated cardiomyopathy (DCM)
    3479 (IGF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3479 (IGF1)
   01522 Endocrine resistance
    3479 (IGF1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3479 (IGF1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   3479 (IGF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Insulin DUF2865
Motif
Other DBs
NCBI-GeneID: 3479
NCBI-ProteinID: NP_001104755
OMIM: 147440
HGNC: 5464
Ensembl: ENSG00000017427
Vega: OTTHUMG00000149910
Pharos: P05019(Tbio)
CPD: C16131
UniProt: P05019
LinkDB All DBs
Structure
PDB: 

Position
12q23.2
AA seq 195 aa AA seqDB search
MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVD
ALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARS
VRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRR
EIGSRNAECRGKKGK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaatcagcagtcttccaacccaattatttaagtgctgcttttgtgatttcttg
aaggtgaagatgcacaccatgtcctcctcgcatctcttctacctggcgctgtgcctgctc
accttcaccagctctgccacggctggaccggagacgctctgcggggctgagctggtggat
gctcttcagttcgtgtgtggagacaggggcttttatttcaacaagcccacagggtatggc
tccagcagtcggagggcgcctcagacaggcatcgtggatgagtgctgcttccggagctgt
gatctaaggaggctggagatgtattgcgcacccctcaagcctgccaagtcagctcgctct
gtccgtgcccagcgccacaccgacatgcccaagacccagaagtatcagcccccatctacc
aacaagaacacgaagtctcagagaaggaaaggttggccaaagacacatccaggaggggaa
cagaaggaggggacagaagcaagtctgcagatcagaggaaagaagaaagagcagaggagg
gagattggaagtagaaatgctgaatgcagaggcaaaaaaggaaaatga

KEGG   Homo sapiens (human): 4609Help
Entry
4609              CDS       T01001                                 

Gene name
MYC, MRTL, MYCC, bHLHe39, c-Myc
Definition
(RefSeq) MYC proto-oncogene, bHLH transcription factor
  KO
K04377  Myc proto-oncogene protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04110  Cell cycle
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04630  Jak-STAT signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05216  Thyroid cancer
hsa05219  Bladder cancer
hsa05220  Chronic myeloid leukemia
hsa05221  Acute myeloid leukemia
hsa05222  Small cell lung cancer
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
Network
nt06115  WNT signaling (viruses)
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06163  Hepatitis C virus (HCV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06210  ERK signaling
nt06215  WNT signaling
nt06227  NR signaling
nt06230  Cell cycle G1/S
nt06240  Transcription
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06265  Bladder cancer
nt06267  Small cell lung cancer
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
nt06275  Acute myeloid leukemia
  Element
N00011  Mutation-activated FGFR3 to RAS-ERK signaling pathway
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00061  CDH1-reduced expression to beta-catenin signaling pathway
N00077  HRAS-overexpression to ERK signaling pathway
N00078  Mutation-activated HRAS to ERK signaling pathway
N00088  Amplified MYC to p15-cell cycle G1/S
N00089  Amplified MYC to cell cycle G1/S
N00090  p15-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00110  PLZF-RARA fusion to transcriptional activtion
N00133  EWSR1-FLI1 fusion to transcriptional activation
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
N00257  Loss of CDH1 to beta-catenin signaling pathway
N00258  Mutation-inactivated CDH1 to beta-catenin signaling pathway
N00287  ESR1-positive to nuclear-initiated estrogen signaling pathway
N00489  HTLV-1 p30II to c-myc-mediated transcription
N00512  HTLV-1 Tax to c-myc-mediated transcription
N00529  HCV core to RXRA/PPARA-mediated transcription
N00530  HCV core to RXRA/LXRA-mediated transcription
Disease
H00001  B-cell acute lymphoblastic leukemia
H00002  T-cell acute lymphoblastic leukemia
H00008  Burkitt lymphoma
H00010  Multiple myeloma
H00013  Small cell lung cancer
H00016  Oral cancer
H00025  Penile cancer
H00027  Ovarian cancer
H00028  Choriocarcinoma
H00036  Osteosarcoma
H00041  Kaposi sarcoma
H00048  Hepatocellular carcinoma
H00055  Laryngeal cancer
H01463  Mycosis fungoides
H01509  Tonsillar cancer
H01554  Fallopian tube cancer
H01667  Medulloblastoma
Drug target
Omacetaxine mepesuccinate: D08956
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4609 (MYC)
   04012 ErbB signaling pathway
    4609 (MYC)
   04310 Wnt signaling pathway
    4609 (MYC)
   04350 TGF-beta signaling pathway
    4609 (MYC)
   04390 Hippo signaling pathway
    4609 (MYC)
   04630 Jak-STAT signaling pathway
    4609 (MYC)
   04151 PI3K-Akt signaling pathway
    4609 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4609 (MYC)
   04218 Cellular senescence
    4609 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4609 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    4609 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4609 (MYC)
   05202 Transcriptional misregulation in cancer
    4609 (MYC)
   05206 MicroRNAs in cancer
    4609 (MYC)
   05205 Proteoglycans in cancer
    4609 (MYC)
   05230 Central carbon metabolism in cancer
    4609 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    4609 (MYC)
   05225 Hepatocellular carcinoma
    4609 (MYC)
   05226 Gastric cancer
    4609 (MYC)
   05216 Thyroid cancer
    4609 (MYC)
   05221 Acute myeloid leukemia
    4609 (MYC)
   05220 Chronic myeloid leukemia
    4609 (MYC)
   05219 Bladder cancer
    4609 (MYC)
   05213 Endometrial cancer
    4609 (MYC)
   05224 Breast cancer
    4609 (MYC)
   05222 Small cell lung cancer
    4609 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4609 (MYC)
   05161 Hepatitis B
    4609 (MYC)
   05160 Hepatitis C
    4609 (MYC)
   05163 Human cytomegalovirus infection
    4609 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4609 (MYC)
   05169 Epstein-Barr virus infection
    4609 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4609 (MYC)
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4609 (MYC)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    4609 (MYC)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     4609 (MYC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Motif
Other DBs
NCBI-GeneID: 4609
NCBI-ProteinID: NP_002458
OMIM: 190080
HGNC: 7553
Ensembl: ENSG00000136997
Vega: OTTHUMG00000128475
Pharos: P01106(Tbio)
UniProt: P01106 A0A087WVR4
LinkDB All DBs
Structure
PDB: 

Position
8q24.21
AA seq 454 aa AA seqDB search
MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAP
SEDIWKKFELLPTPPLSPSRRSGLCSPSYVAVTPFSLRGDNDGGGGSFSTADQLEMVTEL
LGGDMVNQSFICDPDDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPA
RGHSVCSTSSLYLQDLSAAASECIDPSVVFPYPLNDSSSPKSCASQDSSAFSPSSDSLLS
STESSPQGSPEPLVLHEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAG
GHSKPPHSPLVLKRCHVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSP
RSSDTEENVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILS
VQAEEQKLISEEDLLRKRREQLKHKLEQLRNSCA
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
ctggatttttttcgggtagtggaaaaccagcagcctcccgcgacgatgcccctcaacgtt
agcttcaccaacaggaactatgacctcgactacgactcggtgcagccgtatttctactgc
gacgaggaggagaacttctaccagcagcagcagcagagcgagctgcagcccccggcgccc
agcgaggatatctggaagaaattcgagctgctgcccaccccgcccctgtcccctagccgc
cgctccgggctctgctcgccctcctacgttgcggtcacacccttctcccttcggggagac
aacgacggcggtggcgggagcttctccacggccgaccagctggagatggtgaccgagctg
ctgggaggagacatggtgaaccagagtttcatctgcgacccggacgacgagaccttcatc
aaaaacatcatcatccaggactgtatgtggagcggcttctcggccgccgccaagctcgtc
tcagagaagctggcctcctaccaggctgcgcgcaaagacagcggcagcccgaaccccgcc
cgcggccacagcgtctgctccacctccagcttgtacctgcaggatctgagcgccgccgcc
tcagagtgcatcgacccctcggtggtcttcccctaccctctcaacgacagcagctcgccc
aagtcctgcgcctcgcaagactccagcgccttctctccgtcctcggattctctgctctcc
tcgacggagtcctccccgcagggcagccccgagcccctggtgctccatgaggagacaccg
cccaccaccagcagcgactctgaggaggaacaagaagatgaggaagaaatcgatgttgtt
tctgtggaaaagaggcaggctcctggcaaaaggtcagagtctggatcaccttctgctgga
ggccacagcaaacctcctcacagcccactggtcctcaagaggtgccacgtctccacacat
cagcacaactacgcagcgcctccctccactcggaaggactatcctgctgccaagagggtc
aagttggacagtgtcagagtcctgagacagatcagcaacaaccgaaaatgcaccagcccc
aggtcctcggacaccgaggagaatgtcaagaggcgaacacacaacgtcttggagcgccag
aggaggaacgagctaaaacggagcttttttgccctgcgtgaccagatcccggagttggaa
aacaatgaaaaggcccccaaggtagttatccttaaaaaagccacagcatacatcctgtcc
gtccaagcagaggagcaaaagctcatttctgaagaggacttgttgcggaaacgacgagaa
cagttgaaacacaaacttgaacagctacggaactcttgtgcgtaa

KEGG   Homo sapiens (human): 3398Help
Entry
3398              CDS       T01001                                 

Gene name
ID2, GIG8, ID2A, ID2H, bHLHb26
Definition
(RefSeq) inhibitor of DNA binding 2
  KO
K17693  DNA-binding protein inhibitor ID2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00133  EWSR1-FLI1 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    3398 (ID2)
   04390 Hippo signaling pathway
    3398 (ID2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    3398 (ID2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3398 (ID2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3398 (ID2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    3398 (ID2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 3398
NCBI-ProteinID: NP_002157
OMIM: 600386
HGNC: 5361
Ensembl: ENSG00000115738
Vega: OTTHUMG00000112454
Pharos: Q02363(Tbio)
UniProt: Q02363 Q53T66
LinkDB All DBs
Structure
PDB: 

Position
2p25.1
AA seq 134 aa AA seqDB search
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccttcagtcccgtgaggtccgttaggaaaaacagcctgtcggaccacagcctg
ggcatctcccggagcaaaacccctgtggacgacccgatgagcctgctatacaacatgaac
gactgctactccaagctcaaggagctggtgcccagcatcccccagaacaagaaggtgagc
aagatggaaatcctgcagcacgtcatcgactacatcttggacctgcagatcgccctggac
tcgcatcccactattgtcagcctgcatcaccagagacccgggcagaaccaggcgtccagg
acgccgctgaccaccctcaacacggatatcagcatcctgtccttgcaggcttctgaattc
ccttctgagttaatgtcaaatgacagcaaagcactgtgtggctga

DBGET integrated database retrieval system