KEGG   Homo sapiens (human): 3483
Entry
3483              CDS       T01001                                 

Gene name
IGFALS, ACLSD, ALS
Definition
(RefSeq) insulin like growth factor binding protein acid labile subunit
  KO
K17256  insulin-like growth factor-binding protein complex acid labile subunit
Organism
hsa  Homo sapiens (human)
Pathway
hsa04935  Growth hormone synthesis, secretion and action
Disease
H01907  Acid-labile subunit deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    3483 (IGFALS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3483 (IGFALS)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3483 (IGFALS)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_9 LRRNT
Other DBs
NCBI-GeneID: 3483
NCBI-ProteinID: NP_004961
OMIM: 601489
HGNC: 5468
Ensembl: ENSG00000099769
Vega: OTTHUMG00000128638
Pharos: P35858(Tbio)
UniProt: P35858 Q8TAY0
LinkDB
Position
16p13.3
AA seq 605 aa
MALRKGGLALALLLLSWVALGPRSLEGADPGTPGEAEGPACPAACVCSYDDDADELSVFC
SSRNLTRLPDGVPGGTQALWLDGNNLSSVPPAAFQNLSSLGFLNLQGGQLGSLEPQALLG
LENLCHLHLERNQLRSLALGTFAHTPALASLGLSNNRLSRLEDGLFEGLGSLWDLNLGWN
SLAVLPDAAFRGLGSLRELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQ
LPRLQKLYLDRNLIAAVAPGAFLGLKALRWLDLSHNRVAGLLEDTFPGLLGLRVLRLSHN
AIASLRPRTFKDLHFLEELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLG
LTNVAVMNLSGNCLRNLPEQVFRGLGKLHSLHLEGSCLGRIRPHTFTGLSGLRRLFLKDN
GLVGIEEQSLWGLAELLELDLTSNQLTHLPHRLFQGLGKLEYLLLSRNRLAELPADALGP
LQRAFWLDVSHNRLEALPNSLLAPLGRLRYLSLRNNSLRTFTPQPPGLERLWLEGNPWDC
GCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEA
HFAPC
NT seq 1818 nt   +upstreamnt  +downstreamnt
atggccctgaggaaaggaggcctggccctggcgctgctgctgctgtcctgggtggcactg
ggcccccgcagcctggagggagcagaccccggaacgccgggggaagccgagggcccagcg
tgcccggccgcctgtgtctgcagctacgatgacgacgcggatgagctcagcgtcttctgc
agctccaggaacctcacgcgcctgcctgatggagtcccgggcggcacccaagccctgtgg
ctggacggcaacaacctctcgtccgtccccccggcagccttccagaacctctccagcctg
ggcttcctcaacctgcagggcggccagctgggcagcctggagccacaggcgctgctgggc
ctagagaacctgtgccacctgcacctggagcggaaccagctgcgcagcctggcactcggc
acgtttgcacacacgcccgcgctggcctcgctcggcctcagcaacaaccgtctgagcagg
ctggaggacgggctcttcgagggcctcggcagcctctgggacctcaacctcggctggaat
agcctggcggtgctccccgatgcggcgttccgcggcctgggcagcctgcgcgagctggtg
ctggcgggcaacaggctggcctacctgcagcccgcgctcttcagcggcctggccgagctc
cgggagctggacctgagcaggaacgcgctgcgggccatcaaggcaaacgtgttcgtgcag
ctgccccggctccagaaactctacctggaccgcaacctcatcgctgccgtggccccgggc
gccttcctgggcctgaaggcgctgcgatggctggacctgtcccacaaccgcgtggctggc
ctcctggaggacacgttccccggtctgctgggcctgcgtgtgctgcggctgtcccacaac
gccatcgccagcctgcggccccgcaccttcaaggacctgcacttcctggaggagctgcag
ctgggccacaaccgcatccggcagctggctgagcgcagctttgagggcctggggcagctt
gaggtgctcacgctagaccacaaccagctccaggaggtcaaggcgggcgctttcctcggc
ctcaccaacgtggcggtcatgaacctctctgggaactgtctccggaaccttccggagcag
gtgttccggggcctgggcaagctgcacagcctgcacctggagggcagctgcctgggacgc
atccgcccgcacaccttcaccggcctctcggggctccgccgactcttcctcaaggacaac
ggcctcgtgggcattgaggagcagagcctgtgggggctggcggagctgctggagctcgac
ctgacctccaaccagctcacgcacctgccccaccgcctcttccagggcctgggcaagctg
gagtacctgctgctctcccgcaaccgcctggcagagctgccggcggacgccctgggcccc
ctgcagcgggccttctggctggacgtctcgcacaaccgcctggaggcattgcccaacagc
ctcttggcaccactggggcggctgcgctacctcagcctcaggaacaactcactgcggacc
ttcacgccgcagcccccgggcctggagcgcctgtggctggagggtaacccctgggactgt
ggctgccctctcaaggcgctgcgggacttcgccctgcagaaccccagtgctgtgccccgc
ttcgtccaggccatctgtgagggggacgattgccagccgcccgcgtacacctacaacaac
atcacctgtgccagcccgcccgaggtcgtggggctcgacctgcgggacctcagcgaggcc
cactttgctccctgctga

DBGET integrated database retrieval system