KEGG   Homo sapiens (human): 3486
Entry
3486              CDS       T01001                                 

Gene name
IGFBP3, BP-53, IBP3
Definition
(RefSeq) insulin like growth factor binding protein 3
  KO
K10138  insulin-like growth factor-binding protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04115  p53 signaling pathway
hsa04218  Cellular senescence
hsa04935  Growth hormone synthesis, secretion and action
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00134  EWSR1-FLI1 fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    3486 (IGFBP3)
   04218 Cellular senescence
    3486 (IGFBP3)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    3486 (IGFBP3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3486 (IGFBP3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3486 (IGFBP3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3486 (IGFBP3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Others
   Insulin-like growth factor-binding proteins
    3486 (IGFBP3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   3486 (IGFBP3)
SSDB
Motif
Pfam: Thyroglobulin_1 IGFBP
Other DBs
NCBI-GeneID: 3486
NCBI-ProteinID: NP_000589
OMIM: 146732
HGNC: 5472
Ensembl: ENSG00000146674
Vega: OTTHUMG00000023769
Pharos: P17936(Tchem)
UniProt: P17936 B3KPF0
LinkDB
Position
7p12.3
AA seq 291 aa
MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK
NT seq 876 nt   +upstreamnt  +downstreamnt
atgcagcgggcgcgacccacgctctgggccgctgcgctgactctgctggtgctgctccgc
gggccgccggtggcgcgggctggcgcgagctcggcgggcttgggtcccgtggtgcgctgc
gagccgtgcgacgcgcgtgcactggcccagtgcgcgcctccgcccgccgtgtgcgcggag
ctggtgcgcgagccgggctgcggctgctgcctgacgtgcgcactgagcgagggccagccg
tgcggcatctacaccgagcgctgtggctccggccttcgctgccagccgtcgcccgacgag
gcgcgaccgctgcaggcgctgctggacggccgcgggctctgcgtcaacgctagtgccgtc
agccgcctgcgcgcctacctgctgccagcgccgccagctccaggaaatgctagtgagtcg
gaggaagaccgcagcgccggcagtgtggagagcccgtccgtctccagcacgcaccgggtg
tctgatcccaagttccaccccctccattcaaagataatcatcatcaagaaagggcatgct
aaagacagccagcgctacaaagttgactacgagtctcagagcacagatacccagaacttc
tcctccgagtccaagcgggagacagaatatggtccctgccgtagagaaatggaagacaca
ctgaatcacctgaagttcctcaatgtgctgagtcccaggggtgtacacattcccaactgt
gacaagaagggattttataagaaaaagcagtgtcgcccttccaaaggcaggaagcggggc
ttctgctggtgtgtggataagtatgggcagcctctcccaggctacaccaccaaggggaag
gaggacgtgcactgctacagcatgcagagcaagtag

DBGET integrated database retrieval system