KEGG   Homo sapiens (human): 348980
Entry
348980            CDS       T01001                                 

Gene name
HCN1, BCNG-1, BCNG1, EIEE24, GEFSP10, HAC-2
Definition
(RefSeq) hyperpolarization activated cyclic nucleotide gated potassium channel 1
  KO
K04954  hyperpolarization activated cyclic nucleotide-gated potassium channel 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04929  GnRH secretion
Disease
H00606  Early infantile epileptic encephalopathy
Drug target
Ivabradine (DG00246): D07165 D08095<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    348980 (HCN1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    348980 (HCN1)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   348980 (HCN1)
SSDB
Motif
Pfam: Ion_trans_N Ion_trans cNMP_binding Ion_trans_2 DUF1759
Other DBs
NCBI-GeneID: 348980
NCBI-ProteinID: NP_066550
OMIM: 602780
HGNC: 4845
Ensembl: ENSG00000164588
Vega: OTTHUMG00000131155
Pharos: O60741(Tclin)
UniProt: O60741 Q86WJ6
LinkDB
Structure
PDB: 
5U6O 5U6P

Position
5p12
AA seq 890 aa
MEGGGKPNSSSNSRDDGNSVFPAKASATGAGPAAAEKRLGTPPGGGGAGAKEHGNSVCFK
VDGGGGGGGGGGGGEEPAGGFEDAEGPRRQYGFMQRQFTSMLQPGVNKFSLRMFGSQKAV
EKEQERVKTAGFWIIHPYSDFRFYWDLIMLIMMVGNLVIIPVGITFFTEQTTTPWIIFNV
ASDTVFLLDLIMNFRTGTVNEDSSEIILDPKVIKMNYLKSWFVVDFISSIPVDYIFLIVE
KGMDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIFN
LIGMMLLLCHWDGCLQFLVPLLQDFPPDCWVSLNEMVNDSWGKQYSYALFKAMSHMLCIG
YGAQAPVSMSDLWITMLSMIVGATCYAMFVGHATALIQSLDSSRRQYQEKYKQVEQYMSF
HKLPADMRQKIHDYYEHRYQGKIFDEENILNELNDPLREEIVNFNCRKLVATMPLFANAD
PNFVTAMLSKLRFEVFQPGDYIIREGAVGKKMYFIQHGVAGVITKSSKEMKLTDGSYFGE
ICLLTKGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRIGKKNSI
LLQKFQKDLNTGVFNNQENEILKQIVKHDREMVQAIAPINYPQMTTLNSTSSTTTPTSRM
RTQSPPVYTATSLSHSNLHSPSPSTQTPQPSAILSPCSYTTAVCSPPVQSPLAARTFHYA
SPTASQLSLMQQQPQQQVQQSQPPQTQPQQPSPQPQTPGSSTPKNEVHKSTQALHNTNLT
REVRPLSASQPSLPHEVSTLISRPHPTVGESLASIPQPVTAVPGTGLQAGGRSTVPQRVT
LFRQMSSGAIPPNRGVPPAPPPPAAALPRESSSVLNTDPDAEKPRFASNL
NT seq 2673 nt   +upstreamnt  +downstreamnt
atggaaggaggcggcaagcccaactcttcgtctaacagccgggacgatggcaacagcgtc
ttccccgccaaggcgtccgcgacgggcgcggggccggccgcggccgagaagcgcctgggc
accccgccggggggcggcggggccggcgcgaaggagcacggcaactccgtgtgcttcaag
gtggacggcggtggcggcggtggcggcggcggcggcggcggcgaggagccggcggggggc
ttcgaagacgccgaggggccccggcggcagtacggcttcatgcagaggcagttcacctcc
atgctgcagcccggggtcaacaaattctccctccgcatgtttgggagccagaaggcggtg
gaaaaggagcaggaaagggttaaaactgcaggcttctggattatccacccttacagtgat
ttcaggttttactgggatttaataatgcttataatgatggttggaaatctagtcatcata
ccagttggaatcacattctttacagagcaaacaacaacaccatggattattttcaatgtg
gcatcagatacagttttcctattggacctgatcatgaattttaggactgggactgtcaat
gaagacagttctgaaatcatcctggaccccaaagtgatcaagatgaattatttaaaaagc
tggtttgtggttgacttcatctcatccatcccagtggattatatctttcttattgtagaa
aaaggaatggattctgaagtttacaagacagccagggcacttcgcattgtgaggtttaca
aaaattctcagtctcttgcgtttattacgactttcaaggttaattagatacatacatcaa
tgggaagagatattccacatgacatatgatctcgccagtgcagtggtgagaatttttaat
ctcatcggcatgatgctgctcctgtgccactgggatggttgtcttcagttcttagtacca
ctactgcaggacttcccaccagattgctgggtgtctttaaatgaaatggttaatgattct
tggggaaagcagtattcatacgcactcttcaaagctatgagtcacatgctgtgcattggg
tatggagcccaagccccagtcagcatgtctgacctctggattaccatgctgagcatgatc
gtcggggccacctgctatgccatgtttgtcggccatgccaccgctttaatccagtctctg
gattcttcgaggcggcagtatcaagagaagtataagcaagtggaacaatacatgtcattc
cataagttaccagctgatatgcgtcagaagatacatgattactatgaacacagataccaa
ggcaaaatctttgatgaggaaaatattctcaatgaactcaatgatcctctgagagaggag
atagtcaacttcaactgtcggaaactggtggctacaatgcctttatttgctaatgcggat
cctaattttgtgactgccatgctgagcaagttgagatttgaggtgtttcaacctggagat
tatatcatacgagaaggagccgtgggtaaaaaaatgtatttcattcaacacggtgttgct
ggtgtcattacaaaatccagtaaagaaatgaagctgacagatggctcttactttggagag
atttgcctgctgaccaaaggacgtcgtactgccagtgttcgagctgatacatattgtcgt
ctttactcactttccgtggacaatttcaacgaggtcctggaggaatatccaatgatgagg
agagcctttgagacagttgccattgaccgactagatcgaataggaaagaaaaattcaatt
cttctgcaaaagttccagaaggatctgaacactggtgttttcaacaatcaggagaacgaa
atcctcaagcagattgtgaaacatgacagggagatggtgcaggcaatcgctcccatcaat
tatcctcaaatgacaaccctgaattccacatcgtctactacgaccccgacctcccgcatg
aggacacaatctccaccggtgtacacagcgaccagcctgtctcacagcaacctgcactcc
cccagtcccagcacacagaccccccagccatcagccatcctgtcaccctgctcctacacc
accgcggtctgcagccctcctgtacagagccctctggccgctcgaactttccactatgcc
tcccccaccgcctcccagctgtcactcatgcaacagcagccgcagcagcaggtacagcag
tcccagccgccgcagactcagccacagcagccgtccccgcagccacagacacctggcagc
tccacgccgaaaaatgaagtgcacaagagcacgcaggcgcttcacaacaccaacctgacc
cgggaagtcaggccactctccgcctcgcagccctcgctgccccatgaggtgtccactctg
atttccagacctcatcccactgtgggcgagtccctggcctccatccctcaacccgtgacg
gcggtccccggaacgggccttcaggcagggggcaggagcactgtcccgcagcgcgtcacc
ctcttccgacagatgtcgtcgggagccatccccccgaaccgaggagtccctccagcaccc
cctccaccagcagctgctcttccaagagaatcttcctcagtcttaaacacagacccagac
gcagaaaagccacgatttgcttcaaatttatga

KEGG   Homo sapiens (human): 57657
Entry
57657             CDS       T01001                                 

Gene name
HCN3
Definition
(RefSeq) hyperpolarization activated cyclic nucleotide gated potassium channel 3
  KO
K04956  hyperpolarization activated cyclic nucleotide-gated potassium channel 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04929  GnRH secretion
Drug target
Ivabradine (DG00246): D07165 D08095<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    57657 (HCN3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    57657 (HCN3)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   57657 (HCN3)
SSDB
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2
Other DBs
NCBI-GeneID: 57657
NCBI-ProteinID: NP_065948
OMIM: 609973
HGNC: 19183
Ensembl: ENSG00000143630
Vega: OTTHUMG00000035872
Pharos: Q9P1Z3(Tclin)
UniProt: Q9P1Z3
LinkDB
Position
1q22
AA seq 774 aa
MEAEQRPAAGASEGATPGLEAVPPVAPPPATAASGPIPKSGPEPKRRHLGTLLQPTVNKF
SLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKE
ENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAIRTRYLRTWFLVDLISS
IPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHM
TYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYSH
ALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQY
QEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCR
GLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGA
RDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVA
MDRLLRIGKKNSILQRKRSEPSPGSSGGIMEQHLVQHDRDMARGVRGRAPSTGAQLSGKP
VLWEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV
RAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSASQPSLP
QRATGDGSPGRKGSGSERLPPSGLLAKPPRTAQPPRPPVPEPATPRGLQLSANM
NT seq 2325 nt   +upstreamnt  +downstreamnt
atggaggcagagcagcggccggcggcgggggccagcgaaggggcgacccctggactggag
gcggtgcctcccgttgctcccccgcctgcgaccgcggcctcaggtccgatccccaaatct
gggcctgagcctaagaggaggcaccttgggacgctgctccagcctacggtcaacaagttc
tcccttcgggtgttcggcagccacaaagcagtggaaatcgagcaggagcgggtgaagtca
gcgggggcctggatcatccacccctacagcgacttccggttttactgggacctgatcatg
ctgctgctgatggtggggaacctcatcgtcctgcctgtgggcatcaccttcttcaaggag
gagaactccccgccttggatcgtcttcaacgtattgtctgatactttcttcctactggat
ctggtgctcaacttccgaacgggcatcgtggtggaggagggtgctgagatcctgctggca
ccgcgggccatccgcacgcgctacctgcgcacctggttcctggttgacctcatctcttct
atccctgtggattacatcttcctagtggtggagctggagccacggttggacgctgaggtc
tacaaaacggcacgggccctacgcatcgttcgcttcaccaagatcctaagcctgctgagg
ctgctccgcctctcccgcctcatccgctacatacaccagtgggaggagatctttcacatg
acctatgacctggccagtgctgtggttcgcatcttcaacctcattgggatgatgctgctg
ctatgtcactgggatggctgtctgcagttcctggtgcccatgctgcaggacttccctccc
gactgctgggtctccatcaaccacatggtgaaccactcgtggggccgccagtattcccat
gccctgttcaaggccatgagccacatgctgtgcattggctatgggcagcaggcacctgta
ggcatgcccgacgtctggctcaccatgctcagcatgatcgtaggtgccacatgctacgcc
atgttcatcggccatgccacggcactcatccagtccctggactcttcccggcgtcagtac
caggagaagtacaagcaggtggagcagtacatgtccttccacaagctgccagcagacacg
cggcagcgcatccacgagtactatgagcaccgctaccagggcaagatgttcgatgaggaa
agcatcctgggcgagctgagcgagccgcttcgcgaggagatcattaacttcacctgtcgg
ggcctggtggcccacatgccgctgtttgcccatgccgaccccagcttcgtcactgcagtt
ctcaccaagctgcgctttgaggtcttccagccgggggatctcgtggtgcgtgagggctcc
gtggggaggaagatgtacttcatccagcatgggctgctcagtgtgctggcccgcggcgcc
cgggacacacgcctcaccgatggatcctactttggggagatctgcctgctaactaggggc
cggcgcacagccagtgttcgggctgacacctactgccgcctttactcactcagcgtggac
catttcaatgctgtgcttgaggagttccccatgatgcgccgggcctttgagactgtggcc
atggatcggctgctccgcatcggcaagaagaattccatactgcagcggaagcgctccgag
ccaagtccaggcagcagtggtggcatcatggagcagcacttggtgcaacatgacagagac
atggctcggggtgttcggggtcgggccccgagcacaggagctcagcttagtggaaagcca
gtactgtgggagccactggtacatgcgccccttcaggcagctgctgtgacctccaatgtg
gccattgccctgactcatcagcggggccctctgcccctctcccctgactctccagccacc
ctccttgctcgctctgcttggcgctcagcaggctctccagcttccccgctggtgcccgtc
cgagctggcccatgggcatccacctcccgcctgcccgccccacctgcccgaaccctgcac
gccagcctatcccgggcagggcgctcccaggtctccctgctgggtccccctccaggagga
ggtggacggcggctaggacctcggggccgcccactctcagcctcccaaccctctctgcct
cagcgggcaacaggcgatggctctcctgggcgtaagggatcaggaagtgagcggctgcct
ccctcagggctcctggccaaacctccaaggacagcccagccccccaggccaccagtgcct
gagccagccacaccccggggtctccagctttctgccaacatgtaa

KEGG   Homo sapiens (human): 610
Entry
610               CDS       T01001                                 

Gene name
HCN2, BCNG-2, BCNG2, HAC-1
Definition
(RefSeq) hyperpolarization activated cyclic nucleotide gated potassium and sodium channel 2
  KO
K04955  hyperpolarization activated cyclic nucleotide-gated potassium channel 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04929  GnRH secretion
Drug target
Ivabradine (DG00246): D07165 D08095<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    610 (HCN2)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    610 (HCN2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    610 (HCN2)
Ion channels [BR:hsa04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   610 (HCN2)
SSDB
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2
Other DBs
NCBI-GeneID: 610
NCBI-ProteinID: NP_001185
OMIM: 602781
HGNC: 4846
Ensembl: ENSG00000099822
Vega: OTTHUMG00000180590
Pharos: Q9UL51(Tclin)
UniProt: Q9UL51
LinkDB
Structure
PDB: 
3U10 2MPF

Position
19p13.3
AA seq 889 aa
MDARGGGGRPGESPGATPAPGPPPPPPPAPPQQQPPPPPPPAPPPGPGPAPPQHPPRAEA
LPPEAADEGGPRGRLRSRDSSCGRPGTPGAASTAKGSPNGECGRGEPQCSPAGPEGPARG
PKVSFSCRGAASGPAPGPGPAEEAGSEEAGPAGEPRGSQASFMQRQFGALLQPGVNKFSL
RMFGSQKAVEREQERVKSAGAWIIHPYSDFRFYWDFTMLLFMVGNLIIIPVGITFFKDET
TAPWIVFNVVSDTFFLMDLVLNFRTGIVIEDNTEIILDPEKIKKKYLRTWFVVDFVSSIP
VDYIFLIVEKGIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDL
ASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPRNCWVSINGMVNHSWSELYSFALFK
AMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKY
KQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNCRKLVA
SMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMK
LSDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRL
DRIGKKNSILLHKVQHDLNSGVFNNQENAIIQEIVKYDREMVQQAELGQRVGLFPPPPPP
PQVTSAIATLQQAAAMSFCPQVARPLVGPLALGSPRLVRRPPPGPAPAAASPGPPPPASP
PGAPASPRAPRTSPYGGLPAAPLAGPALPARRLSRASRPLSASQPSLPHGAPGPAASTRP
ASSSTPRLGPTPAARAAAPSPDRRDSASPGAAGGLDPQDSARSRLSSNL
NT seq 2670 nt   +upstreamnt  +downstreamnt
atggacgcgcgcgggggcggcgggcggcccggggagagcccgggcgcgacccccgcgccg
gggccgccgccgccgccgccgcccgcgcccccccaacagcagccgccgccgccgccgccg
cccgcgccccccccgggccccgggcccgcgcccccccagcacccgccccgggccgaggcg
ttgcccccggaggcggcggatgagggcggcccgcggggccggctccgcagccgcgacagc
tcgtgcggccgccccggcaccccgggcgcggcgagcacggccaagggcagcccgaacggc
gagtgcgggcgcggcgagccgcagtgcagccccgcggggcccgagggcccggcgcggggg
cccaaggtgtcgttctcgtgccgcggggcggcctcggggcccgcgccggggccggggccg
gcggaggaggcgggcagcgaggaggcgggcccggcgggggagccgcgcggcagccaggcc
agcttcatgcagcgccagttcggcgcgctcctgcagccgggcgtcaacaagttctcgctg
cggatgttcggcagccagaaggccgtggagcgcgagcaggagcgcgtcaagtcggcgggg
gcctggatcatccacccgtacagcgacttcaggttctactgggacttcaccatgctgctg
ttcatggtgggaaacctcatcatcatcccagtgggcatcaccttcttcaaggatgagacc
actgccccgtggatcgtgttcaacgtggtctcggacaccttcttcctcatggacctggtg
ttgaacttccgcaccggcattgtgatcgaggacaacacggagatcatcctggaccccgag
aagatcaagaagaagtatctgcgcacgtggttcgtggtggacttcgtgtcctccatcccc
gtggactacatcttccttatcgtggagaagggcattgactccgaggtctacaagacggca
cgcgccctgcgcatcgtgcgcttcaccaagatcctcagcctcctgcggctgctgcgcctc
tcacgcctgatccgctacatccatcagtgggaggagatcttccacatgacctatgacctg
gccagcgcggtgatgaggatctgcaatctcatcagcatgatgctgctgctctgccactgg
gacggctgcctgcagttcctggtgcctatgctgcaggacttcccgcgcaactgctgggtg
tccatcaatggcatggtgaaccactcgtggagtgaactgtactccttcgcactcttcaag
gccatgagccacatgctgtgcatcgggtacggccggcaggcgcccgagagcatgacggac
atctggctgaccatgctcagcatgattgtgggtgccacctgctacgccatgttcatcggc
cacgccactgccctcatccagtcgctggactcctcgcggcgccagtaccaggagaagtac
aagcaggtggagcagtacatgtccttccacaagctgccagctgacttccgccagaagatc
cacgactactatgagcaccgttaccagggcaagatgtttgacgaggacagcatcctgggc
gagctcaacgggcccctgcgggaggagatcgtcaacttcaactgccggaagctggtggcc
tccatgccgctgttcgccaacgccgaccccaacttcgtcacggccatgctgaccaagctc
aagttcgaggtcttccagccgggtgactacatcatccgcgaaggcaccatcgggaagaag
atgtacttcatccagcacggcgtggtcagcgtgctcactaagggcaacaaggagatgaag
ctgtccgatggctcctacttcggggagatctgcctgctcacccggggccgccgcacggcg
agcgtgcgggctgacacctactgccgcctctattcgctgagcgtggacaacttcaacgag
gtgctggaggagtaccccatgatgcggcgcgccttcgagacggtggccatcgaccgcctg
gaccgcatcggcaagaagaattccatcctcctgcacaaggtgcagcatgacctcaactcg
ggcgtattcaacaaccaggagaacgccatcatccaggagatcgtcaagtacgaccgcgag
atggtgcagcaggccgagctgggtcagcgcgtgggcctcttcccgccgccgccgccgccg
ccgcaggtcacctcggccatcgccacgctgcagcaggcggcggccatgagcttctgcccg
caggtggcgcggccgctcgtggggccgctggcgctcggctcgccgcgcctcgtgcgccgc
ccgcccccggggcccgcacctgccgccgcctcacccgggcccccgccccccgccagcccc
ccgggcgcgcccgccagcccccgggcaccgcggacctcgccctacggcggcctgcccgcc
gccccccttgctgggcccgccctgcccgcgcgccgcctgagccgcgcgtcgcgcccactg
tccgcctcgcagccctcgctgcctcacggcgcccccggccccgcggcctccacacgcccg
gccagcagctccacaccgcgcttggggcccacgcccgctgcccgggccgccgcgcccagc
ccggaccgcagggactcggcctcacccggcgccgccggcggcctggacccccaggactcc
gcgcgctcgcgcctctcgtccaacttgtga

DBGET integrated database retrieval system