KEGG   Homo sapiens (human): 351
Entry
351               CDS       T01001                                 

Gene name
APP, AAA, ABETA, ABPP, AD1, APPI, CTFgamma, CVAP, PN-II, PN2, preA4
Definition
(RefSeq) amyloid beta precursor protein
  KO
K04520  amyloid beta A4 protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04726  Serotonergic synapse
hsa05010  Alzheimer disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06410  Calcium signaling
nt06412  Unfolded protein response (UPR) signaling
nt06414  Apoptosis
nt06417  AGE-RAGE signaling
nt06418  Oxidative phosphorylation
nt06419  Microtubule-based transport
nt06420  Ubiquitin-proteasome system
nt06460  Alzheimer disease
  Element
N00996  Mutation-caused aberrant Abeta to AGE-RAGE signaling pathway
N00997  Mutation-caused aberrant Abeta to electron transfer in Complex I
N00999  Mutation-caused aberrant Abeta to electron transfer in Complex IV
N01001  Mutation-caused aberrant Abeta to mAchR-Ca2+ -apoptotic pathway
N01002  Mutation-caused aberrant Abeta to mGluR5-Ca2+ -apoptotic pathway
N01003  Mutation-caused aberrant Abeta to transport of calcium
N01004  Mutation-caused aberrant Abeta to VGCC-Ca2+ -apoptotic pathway
N01005  Mutation-caused aberrant Abeta to crosstalk between extrinsic and intrinsic apoptotic pathways
N01006  Mutation-caused aberrant Abeta to VGCC-Ca2+ -apoptotic pathway
N01014  Mutation-caused aberrant Abeta to IRE1a-JNK signaling pathway
N01018  Mutation-caused aberrant Abeta to anterograde axonal transport
N01060  Mutation-caused aberrant Abeta to 26S proteasome-mediated protein degradation
Disease
H00056  Alzheimer disease
H01185  Cerebral amyloid angiopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    351 (APP)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    351 (APP)
   05022 Pathways of neurodegeneration - multiple diseases
    351 (APP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    351 (APP)
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    351 (APP)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    351 (APP)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I2: Kunitz - BPTI family
   351 (APP)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Others
   351 (APP)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Others
   351 (APP)
SSDB
Motif
Pfam: APP_E2 APP_N APP_Cu_bd APP_amyloid Beta-APP Kunitz_BPTI Ints3 Insulin_TMD
Other DBs
NCBI-GeneID: 351
NCBI-ProteinID: NP_000475
OMIM: 104760
HGNC: 620
Ensembl: ENSG00000142192
Vega: OTTHUMG00000078438
Pharos: P05067(Tchem)
CPD: C16514 C16515
UniProt: P05067 A0A140VJC8
LinkDB
Structure
PDB: 

Position
21q21.3
AA seq 770 aa
MLPGLALLLLAAWTARALEVPTDGNAGLLAEPQIAMFCGRLNMHMNVQNGKWDSDPSGTK
TCIDTKEGILQYCQEVYPELQITNVVEANQPVTIQNWCKRGRKQCKTHPHFVIPYRCLVG
EFVSDALLVPDKCKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFR
GVEFVCCPLAEESDNVDSADAEEDDSDVWWGGADTDYADGSEDKVVEVAEEEEVAEVEEE
EADDDEDDEDGDEVEEEAEEPYEEATERTTSIATTTTTTTESVEEVVREVCSEQAETGPC
RAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVCGSAMSQSLLKTTQEPLARD
PVKLPTTAASTPDAVDKYLETPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQA
KNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITAL
QAVPPRPRHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYER
MNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMISEPRISYGNDALMPSLTET
KTTVELLPVNGEFSLDDLQPWHSFGADSVPANTENEVEPVDARPAADRGLTTRPGSGLTN
IKTEEISEVKMDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITL
VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgctgcccggtttggcactgctcctgctggccgcctggacggctcgggcgctggaggta
cccactgatggtaatgctggcctgctggctgaaccccagattgccatgttctgtggcaga
ctgaacatgcacatgaatgtccagaatgggaagtgggattcagatccatcagggaccaaa
acctgcattgataccaaggaaggcatcctgcagtattgccaagaagtctaccctgaactg
cagatcaccaatgtggtagaagccaaccaaccagtgaccatccagaactggtgcaagcgg
ggccgcaagcagtgcaagacccatccccactttgtgattccctaccgctgcttagttggt
gagtttgtaagtgatgcccttctcgttcctgacaagtgcaaattcttacaccaggagagg
atggatgtttgcgaaactcatcttcactggcacaccgtcgccaaagagacatgcagtgag
aagagtaccaacttgcatgactacggcatgttgctgccctgcggaattgacaagttccga
ggggtagagtttgtgtgttgcccactggctgaagaaagtgacaatgtggattctgctgat
gcggaggaggatgactcggatgtctggtggggcggagcagacacagactatgcagatggg
agtgaagacaaagtagtagaagtagcagaggaggaagaagtggctgaggtggaagaagaa
gaagccgatgatgacgaggacgatgaggatggtgatgaggtagaggaagaggctgaggaa
ccctacgaagaagccacagagagaaccaccagcattgccaccaccaccaccaccaccaca
gagtctgtggaagaggtggttcgagaggtgtgctctgaacaagccgagacggggccgtgc
cgagcaatgatctcccgctggtactttgatgtgactgaagggaagtgtgccccattcttt
tacggcggatgtggcggcaaccggaacaactttgacacagaagagtactgcatggccgtg
tgtggcagcgccatgtcccaaagtttactcaagactacccaggaacctcttgcccgagat
cctgttaaacttcctacaacagcagccagtacccctgatgccgttgacaagtatctcgag
acacctggggatgagaatgaacatgcccatttccagaaagccaaagagaggcttgaggcc
aagcaccgagagagaatgtcccaggtcatgagagaatgggaagaggcagaacgtcaagca
aagaacttgcctaaagctgataagaaggcagttatccagcatttccaggagaaagtggaa
tctttggaacaggaagcagccaacgagagacagcagctggtggagacacacatggccaga
gtggaagccatgctcaatgaccgccgccgcctggccctggagaactacatcaccgctctg
caggctgttcctcctcggcctcgtcacgtgttcaatatgctaaagaagtatgtccgcgca
gaacagaaggacagacagcacaccctaaagcatttcgagcatgtgcgcatggtggatccc
aagaaagccgctcagatccggtcccaggttatgacacacctccgtgtgatttatgagcgc
atgaatcagtctctctccctgctctacaacgtgcctgcagtggccgaggagattcaggat
gaagttgatgagctgcttcagaaagagcaaaactattcagatgacgtcttggccaacatg
attagtgaaccaaggatcagttacggaaacgatgctctcatgccatctttgaccgaaacg
aaaaccaccgtggagctccttcccgtgaatggagagttcagcctggacgatctccagccg
tggcattcttttggggctgactctgtgccagccaacacagaaaacgaagttgagcctgtt
gatgcccgccctgctgccgaccgaggactgaccactcgaccaggttctgggttgacaaat
atcaagacggaggagatctctgaagtgaagatggatgcagaattccgacatgactcagga
tatgaagttcatcatcaaaaattggtgttctttgcagaagatgtgggttcaaacaaaggt
gcaatcattggactcatggtgggcggtgttgtcatagcgacagtgatcgtcatcaccttg
gtgatgctgaagaagaaacagtacacatccattcatcatggtgtggtggaggttgacgcc
gctgtcaccccagaggagcgccacctgtccaagatgcagcagaacggctacgaaaatcca
acctacaagttctttgagcagatgcagaactag

DBGET integrated database retrieval system