KEGG   Homo sapiens (human): 353Help
Entry
353               CDS       T01001                                 

Gene name
APRT, AMP, APRTD
Definition
(RefSeq) adenine phosphoribosyltransferase
  KO
K00759  adenine phosphoribosyltransferase [EC:2.4.2.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa01100  Metabolic pathways
Disease
H00195  Adenine phosphoribosyltransferase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    353 (APRT)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.7  adenine phosphoribosyltransferase
     353 (APRT)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   353 (APRT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pribosyltran UPRTase PRTase_2
Motif
Other DBs
NCBI-GeneID: 353
NCBI-ProteinID: NP_000476
OMIM: 102600
HGNC: 626
Ensembl: ENSG00000198931
Vega: OTTHUMG00000175454
Pharos: P07741(Tbio)
UniProt: P07741
LinkDB All DBs
Structure
PDB: 

Position
16q24.3
AA seq 180 aa AA seqDB search
MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDY
IAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPG
QRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccgactccgagctgcagctggttgagcagcggatccgcagcttccccgacttcccc
accccaggcgtggtattcagggacatctcgcccgtcctgaaggaccccgcctccttccgc
gccgccatcggcctcctggcgcgacacctgaaggcgacccacgggggccgcatcgactac
atcgcaggcctagactcccgaggcttcctctttggcccctccctggcccaggagcttgga
ctgggctgcgtgctcatccgaaagcgggggaagctgccaggccccactctgtgggcctcc
tattccctggagtacgggaaggctgagctggagattcagaaagacgccctggagccagga
cagagggtggtcgtcgtggatgatctgctggccactggtggaaccatgaacgctgcctgt
gagctgctgggccgcctgcaggctgaggtcctggagtgcgtgagcctggtggagctgacc
tcgcttaagggcagggagaagctggcacctgtacccttcttctctctcctgcagtatgag
tga

DBGET integrated database retrieval system