KEGG   Homo sapiens (human): 353376Help
Entry
353376            CDS       T01001                                 

Gene name
TICAM2, MyD88-4, TICAM-2, TIRAP3, TIRP, TRAM
Definition
(RefSeq) toll like receptor adaptor molecule 2
  KO
K05409  TRIF-related adaptor molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04217  Necroptosis
hsa04620  Toll-like receptor signaling pathway
hsa05133  Pertussis
hsa05161  Hepatitis B
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06121  TLR signaling (virus)
nt06162  Hepatitis B virus (HBV)
  Element
N00553  TLR4-IRF3/7 signaling pathway
N00554  HBV HBe to TLR4-IRF3/7 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    353376 (TICAM2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    353376 (TICAM2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    353376 (TICAM2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    353376 (TICAM2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    353376 (TICAM2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    353376 (TICAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR_2 TIR
Motif
Other DBs
NCBI-GeneID: 353376
NCBI-ProteinID: NP_067681
OMIM: 608321
HGNC: 21354
Ensembl: ENSG00000243414
Vega: OTTHUMG00000162905
Pharos: Q86XR7(Tbio)
UniProt: Q86XR7
LinkDB All DBs
Structure
PDB: 

Position
5q22.3
AA seq 235 aa AA seqDB search
MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQE
GAQSVEEMFEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQ
HLQNLDDAVNGSAWTILLLTENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPL
PRERTPFALQTINALEEESRGFPTQVERIFQESVYKTQQTIWKETRNMVQRQFIA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcgggaagtctaaaataaattcctgccctctttctctctcttggggtaaaagg
cacagtgtggatacaagtccaggatatcatgagtcagattccaagaagtctgaagatcta
tccttgtgtaatgttgctgagcacagcaatacaacagaggggccaacaggaaagcaggag
ggagctcagagcgtggaagagatgtttgaagaagaagctgaagaagaggtgttcctcaaa
tttgtgatattgcatgcagaagatgacacagatgaagccctcagagtccagaatctgcta
caagatgactttggtatcaaacccggaataatctttgctgagatgccatgtggcagacag
catttacagaatttagatgatgctgtaaatgggtctgcatggacaatcttattactgact
gaaaactttttaagagatacttggtgtaatttccagttctatacgtccctaatgaactcc
gttaacaggcagcataaatacaactctgttatacccatgcggcccctgaacaatcccctt
ccccgagaaaggactccctttgccctccaaaccatcaatgccttagaggaagaaagtcgt
ggatttcctacacaagtagaaagaatttttcaggagtctgtgtataagacacaacaaact
atatggaaagagacaagaaatatggtacaaagacaatttattgcctga

DBGET integrated database retrieval system