KEGG   Homo sapiens (human): 354Help
Entry
354               CDS       T01001                                 

Gene name
KLK3, APS, KLK2A1, PSA, hK3
Definition
(RefSeq) kallikrein related peptidase 3
  KO
K01351  semenogelase [EC:3.4.21.77]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05215  Prostate cancer
Network
nt06227  NR signaling
nt06272  Prostate cancer
  Element
N00083  Androgen receptor signaling pathway
N00084  Amplified AR to androgen receptor signaling pathway
N00085  Mutation-activated AR to androgen receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    354 (KLK3)
  09162 Cancer: specific types
   05215 Prostate cancer
    354 (KLK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    354 (KLK3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.77  semenogelase
     354 (KLK3)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   354 (KLK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986 AXH
Motif
Other DBs
NCBI-GeneID: 354
NCBI-ProteinID: NP_001639
OMIM: 176820
HGNC: 6364
Ensembl: ENSG00000142515
Vega: OTTHUMG00000182867
Pharos: P07288(Tchem)
UniProt: P07288 Q546G3
LinkDB All DBs
Structure
PDB: 

Position
19q13.33
AA seq 261 aa AA seqDB search
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVLVHPQWV
LTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPGDDSSHD
LMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCVDLHVIS
NDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEPCALPERP
SLYTKVVHYRKWIKDTIVANP
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtgggtcccggttgtcttcctcaccctgtccgtgacgtggattggtgctgcacccctc
atcctgtctcggattgtgggaggctgggagtgcgagaagcattcccaaccctggcaggtg
cttgtggcctctcgtggcagggcagtctgcggcggtgttctggtgcacccccagtgggtc
ctcacagctgcccactgcatcaggaacaaaagcgtgatcttgctgggtcggcacagcctg
tttcatcctgaagacacaggccaggtatttcaggtcagccacagcttcccacacccgctc
tacgatatgagcctcctgaagaatcgattcctcaggccaggtgatgactccagccacgac
ctcatgctgctccgcctgtcagagcctgccgagctcacggatgctgtgaaggtcatggac
ctgcccacccaggagccagcactggggaccacctgctacgcctcaggctggggcagcatt
gaaccagaggagttcttgaccccaaagaaacttcagtgtgtggacctccatgttatttcc
aatgacgtgtgtgcgcaagttcaccctcagaaggtgaccaagttcatgctgtgtgctgga
cgctggacagggggcaaaagcacctgctcgggtgattctgggggcccacttgtctgtaat
ggtgtgcttcaaggtatcacgtcatggggcagtgaaccatgtgccctgcccgaaaggcct
tccctgtacaccaaggtggtgcattaccggaagtggatcaaggacaccatcgtggccaac
ccctga

DBGET integrated database retrieval system