KEGG   Homo sapiens (human): 3543
Entry
3543              CDS       T01001                                 

Gene name
IGLL1, 14.1, AGM2, CD179b, IGL1, IGL5, IGLJ14.1, IGLL, IGO, IGVPB, VPREB2
Definition
(RefSeq) immunoglobulin lambda like polypeptide 1
  KO
K06554  immunoglobulin lambda-like polypeptide 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05340  Primary immunodeficiency
Disease
H00085  Agammaglobulinemias
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    3543 (IGLL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3543 (IGLL1)
CD molecules [BR:hsa04090]
 Proteins
  3543 (IGLL1)
SSDB
Motif
Pfam: C1-set Ig_3 C2-set_2 ig Ig_2 I-set DUF5645
Other DBs
NCBI-GeneID: 3543
NCBI-ProteinID: NP_064455
OMIM: 146770
HGNC: 5870
Ensembl: ENSG00000128322
Vega: OTTHUMG00000150673
Pharos: P15814(Tbio)
UniProt: P15814
LinkDB
Structure
PDB: 
2H3N 2H32 2LKQ

Position
22q11.23
AA seq 213 aa
MRPGTGQGGLEAPGEPGPNLRQRWPLLLLGLAVVTHGLLRPTAASQSRALGPGAPGGSSR
SSLRSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKATPSVTLFP
PSSEELQANKATLVCLMNDFYPGILTVTWKADGTPITQGVEMTTPSKQSNNKYAASSYLS
LTPEQWRSRRSYSCQVMHEGSTVEKTVAPAECS
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaggccagggacaggccaggggggccttgaggcccctggtgagccaggccccaacctc
aggcagcgctggcccctgctgctgctgggtctggccgtggtaacccatggcctgctgcgc
ccaacagctgcatcgcagagcagggccctgggccctggagcccctggaggaagcagccgg
tccagcctgaggagccggtggggcaggttcctgctccagcgcggctcctggactggcccc
aggtgctggccccgggggtttcaatccaagcataactcagtgacgcatgtgtttggcagc
gggacccagctcaccgttttaagtcagcccaaggccaccccctcggtcactctgttcccg
ccgtcctctgaggagctccaagccaacaaggctacactggtgtgtctcatgaatgacttt
tatccgggaatcttgacggtgacctggaaggcagatggtacccccatcacccagggcgtg
gagatgaccacgccctccaaacagagcaacaacaagtacgcggccagcagctacctgagc
ctgacgcccgagcagtggaggtcccgcagaagctacagctgccaggtcatgcacgaaggg
agcaccgtggagaagacggtggcccctgcagaatgttcatag

DBGET integrated database retrieval system