KEGG   Homo sapiens (human): 3549Help
Entry
3549              CDS       T01001                                 

Gene name
IHH, BDA1, HHG2
Definition
(RefSeq) Indian hedgehog signaling molecule
  KO
K11989  indian hedgehog
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa05205  Proteoglycans in cancer
Disease
H00482  Brachydactyly
H00675  Acrocapitofemoral dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    3549 (IHH)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    3549 (IHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    3549 (IHH)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C46: hedgehog family
   3549 (IHH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HH_signal Hint Peptidase_M15_3
Motif
Other DBs
NCBI-GeneID: 3549
NCBI-ProteinID: NP_002172
OMIM: 600726
HGNC: 5956
Ensembl: ENSG00000163501
Vega: OTTHUMG00000154631
Pharos: Q14623(Tbio)
UniProt: Q14623
LinkDB All DBs
Structure
PDB: 

Position
2q35
AA seq 411 aa AA seqDB search
MSPARLRPRLHFCLVLLLLLVVPAAWGCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKT
LGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDRLNSLAISVMN
QWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYY
ESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRLESGARVALSAVRPGDRVLAMGEDGSPTF
SDVLIFLDREPHRLRAFQVIETQDPPRRLALTPAHLLFTADNHTEPAARFRATFASHVQP
GQYVLVAGVPGLQPARVAAVSTHVALGAYAPLTKHGTLVVEDVVASCFAAVADHHLAQLA
FWPLRLFHSLAWGSWTPGEGVHWYPQLLYRLGRLLLEEGSFHPLGMSGAGS
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgcccggctccggccccgactgcacttctgcctggtcctgttgctgctgctg
gtggtgccggcggcatggggctgcgggccgggtcgggtggtgggcagccgccggcgaccg
ccacgcaaactcgtgccgctcgcctacaagcagttcagccccaatgtgcccgagaagacc
ctgggcgccagcggacgctatgaaggcaagatcgctcgcagctccgagcgcttcaaggag
ctcacccccaattacaatccagacatcatcttcaaggacgaggagaacacaggcgccgac
cgcctcatgacccagcgctgcaaggaccgcctgaactcgctggctatctcggtgatgaac
cagtggcccggtgtgaagctgcgggtgaccgagggctgggacgaggacggccaccactca
gaggagtccctgcattatgagggccgcgcggtggacatcaccacatcagaccgcgaccgc
aataagtatggactgctggcgcgcttggcagtggaggccggctttgactgggtgtattac
gagtcaaaggcccacgtgcattgctccgtcaagtccgagcactcggccgcagccaagacg
ggcggctgcttccctgccggagcccaggtacgcctggagagtggggcgcgtgtggccttg
tcagccgtgaggccgggagaccgtgtgctggccatgggggaggatgggagccccaccttc
agcgatgtgctcattttcctggaccgcgagcctcacaggctgagagccttccaggtcatc
gagactcaggaccccccacgccgcctggcactcacacccgctcacctgctctttacggct
gacaatcacacggagccggcagcccgcttccgggccacatttgccagccacgtgcagcct
ggccagtacgtgctggtggctggggtgccaggcctgcagcctgcccgcgtggcagctgtc
tctacacacgtggccctcggggcctacgccccgctcacaaagcatgggacactggtggtg
gaggatgtggtggcatcctgcttcgcggccgtggctgaccaccacctggctcagttggcc
ttctggcccctgagactctttcacagcttggcatggggcagctggactccgggggagggt
gtgcattggtacccccagctgctctaccgcctggggcgtctcctgctagaagagggcagc
ttccacccactgggcatgtccggggcagggagctga

DBGET integrated database retrieval system