KEGG   Homo sapiens (human): 3559Help
Entry
3559              CDS       T01001                                 

Gene name
IL2RA, CD25, IDDM10, IL2R, IMD41, TCGFR, p55
Definition
(RefSeq) interleukin 2 receptor subunit alpha
  KO
K05068  interleukin 2 receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
Disease
H00091  T-B+Severe combined immunodeficiency
H00408  Type 1 diabetes mellitus
Drug target
Aldesleukin: D00748
Antithymocyte immunoglobulin (rabbit): D09190
Basiliximab: D03058
Camidanlumab: D11324
Camidanlumab tesirine: D11325
Celmoleukin: D02743
Daclizumab: D03639
Denileukin diftitox: D03682
Teceleukin: D02749
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3559 (IL2RA)
   04151 PI3K-Akt signaling pathway
    3559 (IL2RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3559 (IL2RA)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3559 (IL2RA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3559 (IL2RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3559 (IL2RA)
   04658 Th1 and Th2 cell differentiation
    3559 (IL2RA)
   04659 Th17 cell differentiation
    3559 (IL2RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3559 (IL2RA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3559 (IL2RA)
   05162 Measles
    3559 (IL2RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3559 (IL2RA)
   04090 CD molecules [BR:hsa04090]
    3559 (IL2RA)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3559 (IL2RA)
CD molecules [BR:hsa04090]
 Proteins
  3559 (IL2RA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi
Motif
Other DBs
NCBI-GeneID: 3559
NCBI-ProteinID: NP_000408
OMIM: 147730
HGNC: 6008
Ensembl: ENSG00000134460
Vega: OTTHUMG00000017616
Pharos: P01589(Tclin)
UniProt: P01589
LinkDB All DBs
Structure
PDB: 

Position
10p15.1
AA seq 272 aa AA seqDB search
MDSYLLMWGLLTFIMVPGCQAELCDDDPPEIPHATFKAMAYKEGTMLNCECKRGFRRIKS
GSLYMLCTGNSSHSSWDNQCQCTSSATRNTTKQVTPQPEEQKERKTTEMQSPMQPVDQAS
LPGHCREPPPWENEATERIYHFVVGQMVYYQCVQGYRALHRGPAESVCKMTHGKTRWTQP
QLICTGEMETSQFPGEEKPQASPEGRPESETSCLVTTTDFQIQTEMAATMETSIFTTEYQ
VAVAGCVFLLISVLLLSGLTWQRRQRKSRRTI
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggattcatacctgctgatgtggggactgctcacgttcatcatggtgcctggctgccag
gcagagctctgtgacgatgacccgccagagatcccacacgccacattcaaagccatggcc
tacaaggaaggaaccatgttgaactgtgaatgcaagagaggtttccgcagaataaaaagc
gggtcactctatatgctctgtacaggaaactctagccactcgtcctgggacaaccaatgt
caatgcacaagctctgccactcggaacacaacgaaacaagtgacacctcaacctgaagaa
cagaaagaaaggaaaaccacagaaatgcaaagtccaatgcagccagtggaccaagcgagc
cttccaggtcactgcagggaacctccaccatgggaaaatgaagccacagagagaatttat
catttcgtggtggggcagatggtttattatcagtgcgtccagggatacagggctctacac
agaggtcctgctgagagcgtctgcaaaatgacccacgggaagacaaggtggacccagccc
cagctcatatgcacaggtgaaatggagaccagtcagtttccaggtgaagagaagcctcag
gcaagccccgaaggccgtcctgagagtgagacttcctgcctcgtcacaacaacagatttt
caaatacagacagaaatggctgcaaccatggagacgtccatatttacaacagagtaccag
gtagcagtggccggctgtgttttcctgctgatcagcgtcctcctcctgagtgggctcacc
tggcagcggagacagaggaagagtagaagaacaatctag

KEGG   Homo sapiens (human): 3560Help
Entry
3560              CDS       T01001                                 

Gene name
IL2RB, CD122, IL15RB, P70-75
Definition
(RefSeq) interleukin 2 receptor subunit beta
  KO
K05069  interleukin 2 receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06240  Transcription
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00137  EWSR1-WT1 fusion to transcriptional activation
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
Drug target
Aldesleukin: D00748
Celmoleukin: D02743
Teceleukin: D02749
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3560 (IL2RB)
   04151 PI3K-Akt signaling pathway
    3560 (IL2RB)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3560 (IL2RB)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3560 (IL2RB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3560 (IL2RB)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3560 (IL2RB)
   04659 Th17 cell differentiation
    3560 (IL2RB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3560 (IL2RB)
   05202 Transcriptional misregulation in cancer
    3560 (IL2RB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3560 (IL2RB)
   05162 Measles
    3560 (IL2RB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3560 (IL2RB)
   04090 CD molecules [BR:hsa04090]
    3560 (IL2RB)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3560 (IL2RB)
CD molecules [BR:hsa04090]
 Proteins
  3560 (IL2RB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL2RB_N1 Pur_ac_phosph_N IL6Ra-bind
Motif
Other DBs
NCBI-GeneID: 3560
NCBI-ProteinID: NP_000869
OMIM: 146710
HGNC: 6009
Ensembl: ENSG00000100385
Vega: OTTHUMG00000150534
Pharos: P14784(Tclin)
UniProt: P14784
LinkDB All DBs
Structure
PDB: 

Position
22q12.3
AA seq 551 aa AA seqDB search
MAAPALSWRLPLLILLLPLATSWASAAVNGTSQFTCFYNSRANISCVWSQDGALQDTSCQ
VHAWPDRRRWNQTCELLPVSQASWACNLILGAPDSQKLTTVDIVTLRVLCREGVRWRVMA
IQDFKPFENLRLMAPISLQVVHVETHRCNISWEISQASHYFERHLEFEARTLSPGHTWEE
APLLTLKQKQEWICLETLTPDTQYEFQVRVKPLQGEFTTWSPWSQPLAFRTKPAALGKDT
IPWLGHLLVGLSGAFGFIILVYLLINCRNTGPWLKKVLKCNTPDPSKFFSQLSSEHGGDV
QKWLSSPFPSSSFSPGGLAPEISPLEVLERDKVTQLLLQQDKVPEPASLSSNHSLTSCFT
NQGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPLSGEDDAYCT
FPSRDDLLLFSPSLLGGPSPPSTAPGGSGAGEERMPPSLQERVPRDWDPQPLGPPTPGVP
DLVDFQPPPELVLREAGEEVPDAGPREGVSFPWSRPPGQGEFRALNARLPLNTDAYLSLQ
ELQGQDPTHLV
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccctgctctgtcctggcgtctgcccctcctcatcctcctcctgcccctggct
acctcttgggcatctgcagcggtgaatggcacttcccagttcacatgcttctacaactcg
agagccaacatctcctgtgtctggagccaagatggggctctgcaggacacttcctgccaa
gtccatgcctggccggacagacggcggtggaaccaaacctgtgagctgctccccgtgagt
caagcatcctgggcctgcaacctgatcctcggagccccagattctcagaaactgaccaca
gttgacatcgtcaccctgagggtgctgtgccgtgagggggtgcgatggagggtgatggcc
atccaggacttcaagccctttgagaaccttcgcctgatggcccccatctccctccaagtt
gtccacgtggagacccacagatgcaacataagctgggaaatctcccaagcctcccactac
tttgaaagacacctggagttcgaggcccggacgctgtccccaggccacacctgggaggag
gcccccctgctgactctcaagcagaagcaggaatggatctgcctggagacgctcacccca
gacacccagtatgagtttcaggtgcgggtcaagcctctgcaaggcgagttcacgacctgg
agcccctggagccagcccctggccttcaggacaaagcctgcagcccttgggaaggacacc
attccgtggctcggccacctcctcgtgggcctcagcggggcttttggcttcatcatctta
gtgtacttgctgatcaactgcaggaacaccgggccatggctgaagaaggtcctgaagtgt
aacaccccagacccctcgaagttcttttcccagctgagctcagagcatggaggagacgtc
cagaagtggctctcttcgcccttcccctcatcgtccttcagccctggcggcctggcacct
gagatctcgccactagaagtgctggagagggacaaggtgacgcagctgctcctgcagcag
gacaaggtgcctgagcccgcatccttaagcagcaaccactcgctgaccagctgcttcacc
aaccagggttacttcttcttccacctcccggatgccttggagatagaggcctgccaggtg
tactttacttacgacccctactcagaggaagaccctgatgagggtgtggccggggcaccc
acagggtcttccccccaacccctgcagcctctgtcaggggaggacgacgcctactgcacc
ttcccctccagggatgacctgctgctcttctcccccagtctcctcggtggccccagcccc
ccaagcactgcccctgggggcagtggggccggtgaagagaggatgcccccttctttgcaa
gaaagagtccccagagactgggacccccagcccctggggcctcccaccccaggagtccca
gacctggtggattttcagccaccccctgagctggtgctgcgagaggctggggaggaggtc
cctgacgctggccccagggagggagtcagtttcccctggtccaggcctcctgggcagggg
gagttcagggcccttaatgctcgcctgcccctgaacactgatgcctacttgtccctccaa
gaactccagggtcaggacccaactcacttggtgtag

KEGG   Homo sapiens (human): 3561Help
Entry
3561              CDS       T01001                                 

Gene name
IL2RG, CD132, CIDX, IL-2RG, IMD4, P64, SCIDX, SCIDX1
Definition
(RefSeq) interleukin 2 receptor subunit gamma
  KO
K05070  interleukin 2 receptor gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa05162  Measles
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05340  Primary immunodeficiency
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00491  HTLV-1 p12 to Jak-STAT signaling pathway
Disease
H00091  T-B+Severe combined immunodeficiency
H00093  Combined immunodeficiency
Drug target
Aldesleukin: D00748
Celmoleukin: D02743
Teceleukin: D02749
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3561 (IL2RG)
   04151 PI3K-Akt signaling pathway
    3561 (IL2RG)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3561 (IL2RG)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3561 (IL2RG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3561 (IL2RG)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    3561 (IL2RG)
   04659 Th17 cell differentiation
    3561 (IL2RG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3561 (IL2RG)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    3561 (IL2RG)
   05340 Primary immunodeficiency
    3561 (IL2RG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3561 (IL2RG)
   05162 Measles
    3561 (IL2RG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    3561 (IL2RG)
   04090 CD molecules [BR:hsa04090]
    3561 (IL2RG)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  IL2 receptor family
   3561 (IL2RG)
CD molecules [BR:hsa04090]
 Proteins
  3561 (IL2RG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6Ra-bind EpoR_lig-bind fn3 IL4Ra_N
Motif
Other DBs
NCBI-GeneID: 3561
NCBI-ProteinID: NP_000197
OMIM: 308380
HGNC: 6010
Ensembl: ENSG00000147168
Vega: OTTHUMG00000021787
Pharos: P31785(Tclin)
UniProt: P31785
LinkDB All DBs
Structure
PDB: 

Position
Xq13.1
AA seq 369 aa AA seqDB search
MLKPSLPFTSLLFLQLPLLGVGLNTTILTPNGNEDTTADFFLTTMPTDSLSVSTLPLPEV
QCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQKK
EIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLHKLSESQLELNWNNRFLN
HCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEW
SHPIHWGSNTSKENPFLFALEAVVISVGSMGLIISLLCVYFWLERTMPRIPTLKNLEDLV
TEYHGNFSAWSGVSKGLAESLQPDYSERLCLVSEIPPKGGALGEGPGASPCNQHSPYWAP
PCYTLKPET
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagccatcattaccattcacatccctcttattcctgcagctgcccctgctggga
gtggggctgaacacgacaattctgacgcccaatgggaatgaagacaccacagctgatttc
ttcctgaccactatgcccactgactccctcagtgtttccactctgcccctcccagaggtt
cagtgttttgtgttcaatgtcgagtacatgaattgcacttggaacagcagctctgagccc
cagcctaccaacctcactctgcattattggtacaagaactcggataatgataaagtccag
aagtgcagccactatctattctctgaagaaatcacttctggctgtcagttgcaaaaaaag
gagatccacctctaccaaacatttgttgttcagctccaggacccacgggaacccaggaga
caggccacacagatgctaaaactgcagaatctggtgatcccctgggctccagagaaccta
acacttcacaaactgagtgaatcccagctagaactgaactggaacaacagattcttgaac
cactgtttggagcacttggtgcagtaccggactgactgggaccacagctggactgaacaa
tcagtggattatagacataagttctccttgcctagtgtggatgggcagaaacgctacacg
tttcgtgttcggagccgctttaacccactctgtggaagtgctcagcattggagtgaatgg
agccacccaatccactgggggagcaatacttcaaaagagaatcctttcctgtttgcattg
gaagccgtggttatctctgttggctccatgggattgattatcagccttctctgtgtgtat
ttctggctggaacggacgatgccccgaattcccaccctgaagaacctagaggatcttgtt
actgaataccacgggaacttttcggcctggagtggtgtgtctaagggactggctgagagt
ctgcagccagactacagtgaacgactctgcctcgtcagtgagattcccccaaaaggaggg
gcccttggggaggggcctggggcctccccatgcaaccagcatagcccctactgggccccc
ccatgttacaccctaaagcctgaaacctga

DBGET integrated database retrieval system