KEGG   Homo sapiens (human): 3562Help
Entry
3562              CDS       T01001                                 

Gene name
IL3, IL-3, MCGF, MULTI-CSF
Definition
(RefSeq) interleukin 3
  KO
K04736  interleukin 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04210  Apoptosis
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04664  Fc epsilon RI signaling pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05310  Asthma
Network
nt06119  JAK-STAT signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06219  JAK-STAT signaling
nt06240  Transcription
nt06266  Non-small cell lung cancer
nt06275  Acute myeloid leukemia
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3562 (IL3)
   04151 PI3K-Akt signaling pathway
    3562 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3562 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    3562 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3562 (IL3)
   04664 Fc epsilon RI signaling pathway
    3562 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3562 (IL3)
   05202 Transcriptional misregulation in cancer
    3562 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    3562 (IL3)
  09163 Immune disease
   05310 Asthma
    3562 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3562 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3562 (IL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3562 (IL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   3562 (IL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL3 Ldl_recept_b
Motif
Other DBs
NCBI-GeneID: 3562
NCBI-ProteinID: NP_000579
OMIM: 147740
HGNC: 6011
Ensembl: ENSG00000164399
Vega: OTTHUMG00000059640
Pharos: P08700(Tbio)
UniProt: P08700
LinkDB All DBs
Structure
PDB: 

Position
5q31.1
AA seq 152 aa AA seqDB search
MSRLPVLLLLQLLVRPGLQAPMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKD
GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcctgcccgtcctgctcctgctccaactcctggtccgccccggactccaagct
cccatgacccagacaacgcccttgaagacaagctgggttaactgctctaacatgatcgat
gaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaacctcaat
ggggaagaccaagacattctgatggaaaataaccttcgaaggccaaacctggaggcattc
aacagggctgtcaagagtttacagaacgcatcagcaattgagagcattcttaaaaatctc
ctgccatgtctgcccctggccacggccgcacccacgcgacatccaatccatatcaaggac
ggtgactggaatgaattccggaggaaactgacgttctatctgaaaacccttgagaatgcg
caggctcaacagacgactttgagcctcgcgatcttttga

KEGG   Homo sapiens (human): 1437Help
Entry
1437              CDS       T01001                                 

Gene name
CSF2, CSF, GMCSF
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa05132  Salmonella infection
hsa05146  Amoebiasis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05323  Rheumatoid arthritis
Network
nt06110  MAPK signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
N00187  KSHV Kaposin B to p38 signaling pathway
Drug target
Gimsilumab: D11121
Lenzilumab: D11236
Otilimab: D11343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1437 (CSF2)
   04668 TNF signaling pathway
    1437 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1437 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1437 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    1437 (CSF2)
   04660 T cell receptor signaling pathway
    1437 (CSF2)
   04657 IL-17 signaling pathway
    1437 (CSF2)
   04664 Fc epsilon RI signaling pathway
    1437 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1437 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    1437 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    1437 (CSF2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    1437 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1437 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1437 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    1437 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1437 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1437 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1437 (CSF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     1437 (CSF2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1437 (CSF2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Cytokines
   1437 (CSF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GM_CSF
Motif
Other DBs
NCBI-GeneID: 1437
NCBI-ProteinID: NP_000749
OMIM: 138960
HGNC: 2434
Ensembl: ENSG00000164400
Vega: OTTHUMG00000059637
Pharos: P04141(Tbio)
UniProt: P04141
LinkDB All DBs
Structure
PDB: 

Position
5q31.1
AA seq 144 aa AA seqDB search
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcagagcctgctgctcttgggcactgtggcctgcagcatctctgcacccgcc
cgctcgcccagccccagcacgcagccctgggagcatgtgaatgccatccaggaggcccgg
cgtctcctgaacctgagtagagacactgctgctgagatgaatgaaacagtagaagtcatc
tcagaaatgtttgacctccaggagccgacctgcctacagacccgcctggagctgtacaag
cagggcctgcggggcagcctcaccaagctcaagggccccttgaccatgatggccagccac
tacaagcagcactgccctccaaccccggaaacttcctgtgcaacccagattatcaccttt
gaaagtttcaaagagaacctgaaggactttctgcttgtcatcccctttgactgctgggag
ccagtccaggagtga

KEGG   Homo sapiens (human): 4353Help
Entry
4353              CDS       T01001                                 

Gene name
MPO
Definition
(RefSeq) myeloperoxidase
  KO
K10789  myeloperoxidase [EC:1.11.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00983  Drug metabolism - other enzymes
hsa04145  Phagosome
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
Disease
H00101  Other phagocyte defects
H02025  Myeloperoxidase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    4353 (MPO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4353 (MPO)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4353 (MPO)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    4353 (MPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4353 (MPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.2  myeloperoxidase
     4353 (MPO)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   4353 (MPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 4353
NCBI-ProteinID: NP_000241
OMIM: 606989
HGNC: 7218
Ensembl: ENSG00000005381
Vega: OTTHUMG00000178922
Pharos: P05164(Tchem)
UniProt: P05164
LinkDB All DBs
Structure
PDB: 

Position
17q22
AA seq 745 aa AA seqDB search
MGVPFFSSLRCMVDLGPCWAGGLTAEMKLLLALAGLLAILATPQPSEGAAPAVLGEVDTS
LVLSSMEEAKQLVDKAYKERRESIKQRLRSGSASPMELLSYFKQPVAATRTAVRAADYLH
VALDLLERKLRSLWRRPFNVTDVLTPAQLNVLSKSSGCAYQDVGVTCPEQDKYRTITGMC
NNRRSPTLGASNRAFVRWLPAEYEDGFSLPYGWTPGVKRNGFPVALARAVSNEIVRFPTD
QLTPDQERSLMFMQWGQLLDHDLDFTPEPAARASFVTGVNCETSCVQQPPCFPLKIPPND
PRIKNQADCIPFFRSCPACPGSNITIRNQINALTSFVDASMVYGSEEPLARNLRNMSNQL
GLLAVNQRFQDNGRALLPFDNLHDDPCLLTNRSARIPCFLAGDTRSSEMPELTSMHTLLL
REHNRLATELKSLNPRWDGERLYQEARKIVGAMVQIITYRDYLPLVLGPTAMRKYLPTYR
SYNDSVDPRIANVFTNAFRYGHTLIQPFMFRLDNRYQPMEPNPRVPLSRVFFASWRVVLE
GGIDPILRGLMATPAKLNRQNQIAVDEIRERLFEQVMRIGLDLPALNMQRSRDHGLPGYN
AWRRFCGLPQPETVGQLGTVLRNLKLARKLMEQYGTPNNIDIWMGGVSEPLKRKGRVGPL
LACIIGTQFRKLRDGDRFWWENEGVFSMQQRQALAQISLPRIICDNTGITTVSKNNIFMS
NSYPRDFVNCSTLPALNLASWREAS
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atgggggttcccttcttctcttctctcagatgcatggtggacttaggaccttgctgggct
gggggtctcactgcagagatgaagctgcttctggccctagcagggctcctggccattctg
gccacgccccagccctctgaaggtgctgctccagctgtcctgggggaggtggacacctcg
ttggtgctgagctccatggaggaggccaagcagctggtggacaaggcctacaaggagcgg
cgggaaagcatcaagcagcggcttcgcagcggctcagccagccccatggaactcctatcc
tacttcaagcagccggtggcagccaccaggacggcggtgagggccgctgactacctgcac
gtggctctagacctgctggagaggaagctgcggtccctgtggcgaaggccattcaatgtc
actgatgtgctgacgcccgcccagctgaatgtgttgtccaagtcaagcggctgcgcctac
caggacgtgggggtgacttgcccggagcaggacaaataccgcaccatcaccgggatgtgc
aacaacagacgcagccccacgctgggggcctccaaccgtgcctttgtgcgctggctgccg
gcggagtatgaggacggcttctctcttccctacggctggacgcccggggtcaagcgcaac
ggcttcccggtggctctggctcgcgcggtctccaacgagatcgtgcgcttccccactgat
cagctgactccggaccaggagcgctcactcatgttcatgcaatggggccagctgttggac
cacgacctcgacttcacccctgagccggccgcccgggcctccttcgtcactggcgtcaac
tgcgagaccagctgcgttcagcagccgccctgcttcccgctcaagatcccgcccaatgac
ccccgcatcaagaaccaagccgactgcatcccgttcttccgctcctgcccggcttgcccc
gggagcaacatcaccatccgcaaccagatcaacgcgctcacttccttcgtggacgccagc
atggtgtacggcagcgaggagcccctggccaggaacctgcgcaacatgtccaaccagctg
gggctgctggccgtcaaccagcgcttccaagacaacggccgggccctgctgccctttgac
aacctgcacgatgacccctgtctcctcaccaaccgctcagcgcgcatcccctgcttcctg
gcaggggacacccgttccagtgagatgcccgagctcacctccatgcacaccctcttactt
cgggagcacaaccggctggccacagagctcaagagcctgaaccctaggtgggatggggag
aggctctaccaggaagcccggaagatcgtgggggccatggtccagatcatcacttaccgg
gactacctgcccctggtgctggggccaacggccatgaggaagtacctgcccacgtaccgt
tcctacaatgactcagtggacccacgcatcgccaacgtcttcaccaatgccttccgctac
ggccacaccctcatccaacccttcatgttccgcctggacaatcggtaccagcccatggaa
cccaacccccgtgtccccctcagcagggtcttttttgcctcctggagggtcgtgctggaa
ggtggcattgaccccatcctccggggcctcatggccacccctgccaagctgaatcgtcag
aaccaaattgcagtggatgagatccgggagcgattgtttgagcaggtcatgaggattggg
ctggacctgcctgctctgaacatgcagcgcagcagggaccacggcctcccaggatacaat
gcctggaggcgcttctgtgggctcccgcagcctgaaactgtgggccagctgggcacggtg
ctgaggaacctgaaattggcgaggaaactgatggagcagtatggcacgcccaacaacatc
gacatctggatgggcggcgtgtccgagcctctgaagcgcaaaggccgcgtgggcccactc
ctcgcctgcatcatcggtacccagttcaggaagctccgggatggtgatcggttttggtgg
gagaacgagggtgtgttcagcatgcagcagcgacaggccctggcccagatctcattgccc
cggatcatctgcgacaacacaggcatcaccaccgtgtctaagaacaacatcttcatgtcc
aactcatatccccgggactttgtcaactgcagtacacttcctgcattgaacctggcttcc
tggagggaagcctcctag

KEGG   Homo sapiens (human): 1668Help
Entry
1668              CDS       T01001                                 

Gene name
DEFA3, DEF3, HNP-3, HNP3, HP-3, HP3
Definition
(RefSeq) defensin alpha 3
  KO
K05230  defensin, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
hsa05150  Staphylococcus aureus infection
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00118  TEL-AML1 fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    1668 (DEFA3)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1668 (DEFA3)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    1668 (DEFA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_propep Defensin_1 DUF4733
Motif
Other DBs
NCBI-GeneID: 1668
NCBI-ProteinID: NP_005208
OMIM: 604522
HGNC: 2762
Ensembl: ENSG00000239839
Vega: OTTHUMG00000090381
Pharos: P59666(Tbio)
CPD: C16056
UniProt: P59666 Q6EZE9
LinkDB All DBs
Structure
PDB: 

Position
8p23.1
AA seq 94 aa AA seqDB search
MRTLAILAAILLVALQAQAEPLQARADEVAAAPEQIAADIPEVVVSLAWDESLAPKHPGS
RKNMDCYCRIPACIAGERRYGTCIYQGRLWAFCC
NT seq 285 nt NT seq  +upstreamnt  +downstreamnt
atgaggaccctcgccatccttgctgccattctcctggtggccctgcaggcccaggctgag
ccactccaggcaagagctgatgaggttgctgcagccccggagcagattgcagcggacatc
ccagaagtggttgtttcccttgcatgggacgaaagcttggctccaaagcatccaggctca
aggaaaaacatggactgctattgcagaataccagcgtgcattgcaggagaacgtcgctat
ggaacctgcatctaccagggaagactctgggcattctgctgctga

KEGG   Homo sapiens (human): 1991Help
Entry
1991              CDS       T01001                                 

Gene name
ELANE, ELA2, GE, HLE, HNE, NE, PMN-E, SCN1
Definition
(RefSeq) elastase, neutrophil expressed
  KO
K01327  leukocyte elastase [EC:3.4.21.37]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00118  TEL-AML1 fusion to transcriptional repression
Disease
H00100  Neutropenic disorders
Drug target
Depelestat: D03686
Sivelestat (DG01401): D01918 D03788
Ulinastatin: D05183
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1991 (ELANE)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    1991 (ELANE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    1991 (ELANE)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    1991 (ELANE)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1991 (ELANE)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1991 (ELANE)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.37  leukocyte elastase
     1991 (ELANE)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   1991 (ELANE)
Chaperones and folding catalysts [BR:hsa03110]
 Intramolecular chaperones
  Other peptidases
   1991 (ELANE)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   1991 (ELANE)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Enzymes
   1991 (ELANE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 1991
NCBI-ProteinID: NP_001963
OMIM: 130130
HGNC: 3309
Ensembl: ENSG00000197561
Vega: OTTHUMG00000181839
Pharos: P08246(Tchem)
UniProt: P08246
LinkDB All DBs
Structure
PDB: 

Position
19p13.3
AA seq 267 aa AA seqDB search
MTLGRRLACLFLACVLPALLLGGTALASEIVGGRRARPHAWPFMVSLQLRGGHFCGATLI
APNFVMSAAHCVANVNVRAVRVVLGAHNLSRREPTRQVFAVQRIFENGYDPVNLLNDIVI
LQLNGSATINANVQVAQLPAQGRRLGNGVQCLAMGWGLLGRNRGIASVLQELNVTVVTSL
CRRSNVCTLVRGRQAGVCFGDSGSPLVCNGLIHGIASFVRGGCASGLYPDAFAPVAQFVN
WIDSIIQRSEDNPCPHPRDPDPASRTH
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgaccctcggccgccgactcgcgtgtcttttcctcgcctgtgtcctgccggccttgctg
ctggggggcaccgcgctggcctcggagattgtggggggccggcgagcgcggccccacgcg
tggcccttcatggtgtccctgcagctgcgcggaggccacttctgcggcgccaccctgatt
gcgcccaacttcgtcatgtcggccgcgcactgcgtggcgaatgtaaacgtccgcgcggtg
cgggtggtcctgggagcccataacctctcgcggcgggagcccacccggcaggtgttcgcc
gtgcagcgcatcttcgaaaacggctacgaccccgtaaacttgctcaacgacatcgtgatt
ctccagctcaacgggtcggccaccatcaacgccaacgtgcaggtggcccagctgccggct
cagggacgccgcctgggcaacggggtgcagtgcctggccatgggctggggccttctgggc
aggaaccgtgggatcgccagcgtcctgcaggagctcaacgtgacggtggtgacgtccctc
tgccgtcgcagcaacgtctgcactctcgtgaggggccggcaggccggcgtctgtttcggg
gactccggcagccccttggtctgcaacgggctaatccacggaattgcctccttcgtccgg
ggaggctgcgcctcagggctctaccccgatgcctttgccccggtggcacagtttgtaaac
tggatcgactctatcatccaacgctccgaggacaacccctgtccccacccccgggacccg
gacccggccagcaggacccactga

KEGG   Homo sapiens (human): 3002Help
Entry
3002              CDS       T01001                                 

Gene name
GZMB, C11, CCPI, CGL-1, CGL1, CSP-B, CSPB, CTLA1, CTSGL1, HLP, SECT
Definition
(RefSeq) granzyme B
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
hsa04650  Natural killer cell mediated cytotoxicity
hsa04940  Type I diabetes mellitus
hsa05202  Transcriptional misregulation in cancer
hsa05320  Autoimmune thyroid disease
hsa05330  Allograft rejection
hsa05332  Graft-versus-host disease
Network
nt06240  Transcription
  Element
N00118  TEL-AML1 fusion to transcriptional repression
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    3002 (GZMB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3002 (GZMB)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3002 (GZMB)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    3002 (GZMB)
   05330 Allograft rejection
    3002 (GZMB)
   05332 Graft-versus-host disease
    3002 (GZMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    3002 (GZMB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    3002 (GZMB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     3002 (GZMB)
Peptidases [BR:hsa01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   3002 (GZMB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 3002
NCBI-ProteinID: NP_004122
OMIM: 123910
HGNC: 4709
Ensembl: ENSG00000100453
Vega: OTTHUMG00000029369
Pharos: P10144(Tchem)
UniProt: P10144 Q67BC3
LinkDB All DBs
Structure
PDB: 

Position
14q12
AA seq 247 aa AA seqDB search
MQPILLLLAFLLLPRADAGEIIGGHEAKPHSRPYMAYLMIWDQKSLKRCGGFLIRDDFVL
TAAHCWGSSINVTLGAHNIKEQEPTQQFIPVKRPIPHPAYNPKNFSNDIMLLQLERKAKR
TRAVQPLRLPSNKAQVKPGQTCSVAGWGQTAPLGKHSHTLQEVKMTVQEDRKCESDLRHY
YDSTIELCVGDPEIKKTSFKGDSGGPLVCNKVAQGIVSYGRNNGMPPRACTKVSSFVHWI
KKTMKRY
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccaatcctgcttctgctggccttcctcctgctgcccagggcagatgcaggggag
atcatcgggggacatgaggccaagccccactcccgcccctacatggcttatcttatgatc
tgggatcagaagtctctgaagaggtgcggtggcttcctgatacgagacgacttcgtgctg
acagctgctcactgttggggaagctccataaatgtcaccttgggggcccacaatatcaaa
gaacaggagccgacccagcagtttatccctgtgaaaagacccatcccccatccagcctat
aatcctaagaacttctccaacgacatcatgctactgcagctggagagaaaggccaagcgg
accagagctgtgcagcccctcaggctacctagcaacaaggcccaggtgaagccagggcag
acatgcagtgtggccggctgggggcagacggcccccctgggaaaacactcacacacacta
caagaggtgaagatgacagtgcaggaagatcgaaagtgcgaatctgacttacgccattat
tacgacagtaccattgagttgtgcgtgggggacccagagattaaaaagacttcctttaag
ggggactctggaggccctcttgtgtgtaacaaggtggcccagggcattgtctcctatgga
cgaaacaatggcatgcctccacgagcctgcaccaaagtctcaagctttgtacactggata
aagaaaaccatgaaacgctactaa

DBGET integrated database retrieval system