KEGG   Homo sapiens (human): 3569Help
Entry
3569              CDS       T01001                                 

Gene name
IL6, BSF-2, BSF2, CDF, HGF, HSF, IFN-beta-2, IFNB2, IL-6
Definition
(RefSeq) interleukin 6
  KO
K05405  interleukin 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01523  Antifolate resistance
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04218  Cellular senescence
hsa04620  Toll-like receptor signaling pathway
hsa04621  NOD-like receptor signaling pathway
hsa04623  Cytosolic DNA-sensing pathway
hsa04625  C-type lectin receptor signaling pathway
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04657  IL-17 signaling pathway
hsa04659  Th17 cell differentiation
hsa04668  TNF signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa04931  Insulin resistance
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05020  Prion diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
hsa05133  Pertussis
hsa05134  Legionellosis
hsa05135  Yersinia infection
hsa05142  Chagas disease (American trypanosomiasis)
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05146  Amoebiasis
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05162  Measles
hsa05163  Human cytomegalovirus infection
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05321  Inflammatory bowel disease (IBD)
hsa05323  Rheumatoid arthritis
hsa05332  Graft-versus-host disease
hsa05410  Hypertrophic cardiomyopathy (HCM)
Network
nt06110  MAPK signaling (viruses)
nt06119  JAK-STAT signaling (viruses)
nt06121  TLR signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06162  Hepatitis B virus (HBV)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06211  Other MAPK signaling
nt06219  JAK-STAT signaling
nt06224  CXCR signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
nt06266  Non-small cell lung cancer
nt06276  Chronic myeloid leukemia
  Element
N00053  Cytokine-Jak-STAT signaling pathway
N00139  FUS-DDIT3 fusion to CEBPB-mediated transcription
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00187  KSHV Kaposin B to p38 signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00435  TLR2/4-NFKB signaling pathway
N00466  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00467  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00468  EBV BPLF1 to TLR2/4-NFKB signaling pathway
N00859  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00860  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00861  Yersinia YopP/J to TLR2/4-NFKB signaling pathway
N00862  Yersinia YopP/J to TLR2/4-MAPK signaling pathway
N00926  Escherichia Tir to TLR2/4-MAPK signaling pathway
Disease
H00084  Graft-versus-host disease
H01479  Castleman disease
H01672  Juvenile idiopathic arthritis
Drug target
Pirfenidone: D01583
Pomalidomide: D08976
Siltuximab: D09669
Sirukumab: D10080
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    3569 (IL6)
   04668 TNF signaling pathway
    3569 (IL6)
   04066 HIF-1 signaling pathway
    3569 (IL6)
   04068 FoxO signaling pathway
    3569 (IL6)
   04151 PI3K-Akt signaling pathway
    3569 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    3569 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    3569 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    3569 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    3569 (IL6)
   04620 Toll-like receptor signaling pathway
    3569 (IL6)
   04621 NOD-like receptor signaling pathway
    3569 (IL6)
   04623 Cytosolic DNA-sensing pathway
    3569 (IL6)
   04625 C-type lectin receptor signaling pathway
    3569 (IL6)
   04659 Th17 cell differentiation
    3569 (IL6)
   04657 IL-17 signaling pathway
    3569 (IL6)
   04672 Intestinal immune network for IgA production
    3569 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3569 (IL6)
   05202 Transcriptional misregulation in cancer
    3569 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    3569 (IL6)
   05321 Inflammatory bowel disease (IBD)
    3569 (IL6)
   05332 Graft-versus-host disease
    3569 (IL6)
  09164 Neurodegenerative disease
   05020 Prion diseases
    3569 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    3569 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    3569 (IL6)
   04931 Insulin resistance
    3569 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    3569 (IL6)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    3569 (IL6)
   05132 Salmonella infection
    3569 (IL6)
   05135 Yersinia infection
    3569 (IL6)
   05133 Pertussis
    3569 (IL6)
   05134 Legionellosis
    3569 (IL6)
   05152 Tuberculosis
    3569 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3569 (IL6)
   05162 Measles
    3569 (IL6)
   05164 Influenza A
    3569 (IL6)
   05161 Hepatitis B
    3569 (IL6)
   05168 Herpes simplex virus 1 infection
    3569 (IL6)
   05163 Human cytomegalovirus infection
    3569 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    3569 (IL6)
   05169 Epstein-Barr virus infection
    3569 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    3569 (IL6)
   05144 Malaria
    3569 (IL6)
   05142 Chagas disease (American trypanosomiasis)
    3569 (IL6)
   05143 African trypanosomiasis
    3569 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3569 (IL6)
   01523 Antifolate resistance
    3569 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    3569 (IL6)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interleukins
   3569 (IL6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL6 IL11 IL23 Phage_int_SAM_1 GCSF BTHB
Motif
Other DBs
NCBI-GeneID: 3569
NCBI-ProteinID: NP_000591
OMIM: 147620
HGNC: 6018
Ensembl: ENSG00000136244
Vega: OTTHUMG00000023178
Pharos: P05231(Tclin)
UniProt: P05231 Q75MH2 B4DVM1
LinkDB All DBs
Structure
PDB: 

Position
7p15.3
AA seq 212 aa AA seqDB search
MNSFSTSAFGPVAFSLGLLLVLPAAFPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgaactccttctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttccctgccccagtacccccaggagaagattccaaagatgtagcc
gccccacacagacagccactcacctcttcagaacgaattgacaaacaaattcggtacatc
ctcgacggcatctcagccctgagaaaggagacatgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacagatttgagagtagtgaggaacaagcc
agagctgtgcagatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataaccacccctgacccaaccacaaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacaactcatctcattctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtag

KEGG   Homo sapiens (human): 1437Help
Entry
1437              CDS       T01001                                 

Gene name
CSF2, CSF, GMCSF
Definition
(RefSeq) colony stimulating factor 2
  KO
K05427  granulocyte-macrophage colony-stimulating factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
hsa04640  Hematopoietic cell lineage
hsa04650  Natural killer cell mediated cytotoxicity
hsa04657  IL-17 signaling pathway
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04668  TNF signaling pathway
hsa05131  Shigellosis
hsa05146  Amoebiasis
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05323  Rheumatoid arthritis
Network
nt06110  MAPK signaling (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06211  Other MAPK signaling
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00116  Mutation-inactivated RUNX1 to transcription
N00118  TEL-AML1 fusion to transcriptional repression
N00187  KSHV Kaposin B to p38 signaling pathway
Drug target
Gimsilumab: D11121
Lenzilumab: D11236
Otilimab: D11343
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    1437 (CSF2)
   04668 TNF signaling pathway
    1437 (CSF2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    1437 (CSF2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    1437 (CSF2)
   04650 Natural killer cell mediated cytotoxicity
    1437 (CSF2)
   04660 T cell receptor signaling pathway
    1437 (CSF2)
   04657 IL-17 signaling pathway
    1437 (CSF2)
   04664 Fc epsilon RI signaling pathway
    1437 (CSF2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    1437 (CSF2)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    1437 (CSF2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    1437 (CSF2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    1437 (CSF2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1437 (CSF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    1437 (CSF2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    1437 (CSF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1437 (CSF2)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1437 (CSF2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1437 (CSF2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     1437 (CSF2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   1437 (CSF2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Cytokines
   1437 (CSF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GM_CSF
Motif
Other DBs
NCBI-GeneID: 1437
NCBI-ProteinID: NP_000749
OMIM: 138960
HGNC: 2434
Ensembl: ENSG00000164400
Vega: OTTHUMG00000059637
Pharos: P04141(Tbio)
UniProt: P04141
LinkDB All DBs
Structure
PDB: 

Position
5q31.1
AA seq 144 aa AA seqDB search
MWLQSLLLLGTVACSISAPARSPSPSTQPWEHVNAIQEARRLLNLSRDTAAEMNETVEVI
SEMFDLQEPTCLQTRLELYKQGLRGSLTKLKGPLTMMASHYKQHCPPTPETSCATQIITF
ESFKENLKDFLLVIPFDCWEPVQE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcagagcctgctgctcttgggcactgtggcctgcagcatctctgcacccgcc
cgctcgcccagccccagcacgcagccctgggagcatgtgaatgccatccaggaggcccgg
cgtctcctgaacctgagtagagacactgctgctgagatgaatgaaacagtagaagtcatc
tcagaaatgtttgacctccaggagccgacctgcctacagacccgcctggagctgtacaag
cagggcctgcggggcagcctcaccaagctcaagggccccttgaccatgatggccagccac
tacaagcagcactgccctccaaccccggaaacttcctgtgcaacccagattatcaccttt
gaaagtttcaaagagaacctgaaggactttctgcttgtcatcccctttgactgctgggag
ccagtccaggagtga

DBGET integrated database retrieval system